BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30033 (638 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydroge... 82 4e-18 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 4.4 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 7.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 7.6 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 7.6 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 7.6 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 7.6 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 7.6 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 7.6 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.6 >AY217747-1|AAP45005.1| 246|Apis mellifera short-chain dehydrogenase/reductase protein. Length = 246 Score = 82.2 bits (194), Expect = 4e-18 Identities = 52/188 (27%), Positives = 100/188 (53%), Gaps = 9/188 (4%) Frame = +2 Query: 5 DKVVFITGAATGIGESVVRILLDEGVKHIAILDIAEEAGKSLQVELNSKYGNKTKFYRSD 184 D+V +TGA +GIG+ ++ L+ +G+K I I ++ K+L EL SK G K + D Sbjct: 7 DEVALVTGANSGIGKCLIECLVGKGMKVIGIAPQVDKM-KTLVEELKSKPG-KLVPLQCD 64 Query: 185 VTNEEHFLGILNAVVQEQGGIDVVINNA------ALMNDSIGIYKKAIEVNVTALITSTL 346 ++N+ L ++ V + G ID++INNA L ND + +KK ++N+ L Sbjct: 65 LSNQNDILKVIEWVEKNLGAIDILINNATINIDVTLQNDEVLDWKKIFDINLLGLTCMIQ 124 Query: 347 KAIEIMGKHSGGKGGTVINVSSVAALT---QSHVMPIYFATKSAVLQFSNCVGRPEHFSK 517 + +++M K G G ++N++ + L + P Y A+K A+ ++C+ + Sbjct: 125 EVLKLM-KKKGINNGIIVNINDASGLNLLPMNRNRPAYLASKCALTTLTDCLRSELAQCE 183 Query: 518 TGVRVLTV 541 + ++V+++ Sbjct: 184 SNIKVISI 191 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = -2 Query: 58 DHRFTDARCSTGY 20 D+ FT+ RC GY Sbjct: 290 DYGFTECRCDPGY 302 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = +1 Query: 274 HERQYWHLQKSHRGQRDRLNNEYI 345 H R+ W +Q+ + +RL + I Sbjct: 38 HRREVWLIQQEREREHERLMKKMI 61 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,785 Number of Sequences: 438 Number of extensions: 3971 Number of successful extensions: 14 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -