BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30031 (566 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13A11.01c |rga8|SPAC2F7.18c|GTPase activating protein Rga8 |... 26 3.4 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 25 5.9 >SPAC13A11.01c |rga8|SPAC2F7.18c|GTPase activating protein Rga8 |Schizosaccharomyces pombe|chr 1|||Manual Length = 777 Score = 26.2 bits (55), Expect = 3.4 Identities = 9/27 (33%), Positives = 20/27 (74%) Frame = +1 Query: 256 RVVYYKSYYIFLYTVLATLLLSREIVS 336 RV+YYK +++ L T+++ L S ++++ Sbjct: 379 RVLYYKDFFMDLSTIISNFLPSMKLLA 405 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 25.4 bits (53), Expect = 5.9 Identities = 16/49 (32%), Positives = 22/49 (44%) Frame = -2 Query: 274 FYNILLLIXVCSVLAHPHYSYPFT*NTRIYGNHFCLVPNVISVNNDVSN 128 F +I +I C + P FT +H L+P V+ VNND N Sbjct: 1734 FVDIYSVILECFLAIQPRSFPAFTFAWLSLISHSYLLPKVLLVNNDKIN 1782 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,053,394 Number of Sequences: 5004 Number of extensions: 37104 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 71 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 240047038 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -