BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30031 (566 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48809-7|CAA88744.1| 367|Caenorhabditis elegans Hypothetical pr... 28 5.4 AF358857-1|AAK52772.1| 367|Caenorhabditis elegans REF-1 protein. 28 5.4 >Z48809-7|CAA88744.1| 367|Caenorhabditis elegans Hypothetical protein T01E8.2 protein. Length = 367 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -3 Query: 552 HGIQFNQPILKSVKAKIFSDI*TRPLIIYISKL*KYFEYTVLPRPFF 412 H I + K++ + F R L++ + L K+FE+++ P+P F Sbjct: 236 HAIAEGKKTAKNIAFQFFKS--DRHLVVRCADLEKFFEFSLSPKPLF 280 >AF358857-1|AAK52772.1| 367|Caenorhabditis elegans REF-1 protein. Length = 367 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/47 (27%), Positives = 25/47 (53%) Frame = -3 Query: 552 HGIQFNQPILKSVKAKIFSDI*TRPLIIYISKL*KYFEYTVLPRPFF 412 H I + K++ + F R L++ + L K+FE+++ P+P F Sbjct: 236 HAIAEGKKTAKNIAFQFFKS--DRHLVVRCADLEKFFEFSLSPKPLF 280 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,235,379 Number of Sequences: 27780 Number of extensions: 202928 Number of successful extensions: 376 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1176726318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -