BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30027 (323 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 23 0.70 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 3.7 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 3.7 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 3.7 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 20 8.6 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 20 8.6 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 23.4 bits (48), Expect = 0.70 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 280 LLPQMSYVSVRSLGQPLYNETSTSCLKAHHETFIIN 173 ++ + +VSV G +Y ST L+ F+IN Sbjct: 24 VIGMLGFVSVMGNGMVVYIFLSTKSLRTPSNLFVIN 59 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.0 bits (42), Expect = 3.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +3 Query: 90 YRLHCP*FFKTI*PPAYPATGS 155 YRL+ P ++ P YP+T S Sbjct: 426 YRLYNPALIQSQPSPQYPSTSS 447 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 3.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 51 LKVPMSKNQSEDHSKRK 1 L P+SK + ++H K+K Sbjct: 61 LPQPISKRKDKEHKKKK 77 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 3.7 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 51 LKVPMSKNQSEDHSKRK 1 L P+SK + ++H K+K Sbjct: 61 LPQPISKRKDKEHKKKK 77 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +2 Query: 149 RKLDNIIFIDNECLMVSFE 205 R+ ++ IF+ +CL+ + E Sbjct: 118 RRYEDNIFLPEDCLLFTIE 136 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 19.8 bits (39), Expect = 8.6 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = +2 Query: 149 RKLDNIIFIDNECLMVSFE 205 R+ ++ IF+ +CL+ + E Sbjct: 133 RRYEDNIFLPEDCLLFTIE 151 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 83,805 Number of Sequences: 438 Number of extensions: 1642 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7093251 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -