BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30025 (309 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster ... 28 0.28 SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosacch... 23 7.9 >SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 2|||Manual Length = 827 Score = 28.3 bits (60), Expect = 0.28 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -2 Query: 299 HVLLKTFKMKTIYFVLLISVCAVSAIYLPDDSNSADLDKYKSESF 165 H+ KT K + LL++ + Y+PD+S SA+ +++ + Sbjct: 233 HMYYKTGKTDNNFHFLLVATLCLGYTYMPDESPSANYPYHEAYEY 277 >SPAC19G12.10c |cpy1|pcy1|vacuolar carboxypeptidase Y|Schizosaccharomyces pombe|chr 1|||Manual Length = 1002 Score = 23.4 bits (48), Expect = 7.9 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = -2 Query: 278 KMKTIYFVLLISVCAVSAIYLPDDSNSADLDKYKS--ESFGSKLYSE 144 K +YF+L V A Y+P + N D+ K E FG E Sbjct: 4 KQTFLYFLLTCVVSAQFNGYVPPEQNGGDIVVPKDFYEKFGEDFIRE 50 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 667,291 Number of Sequences: 5004 Number of extensions: 8494 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 79841814 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -