BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30024 (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces p... 31 0.12 SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosacc... 27 2.6 SPBC354.14c |vac8||vacuolar protein Vac8|Schizosaccharomyces pom... 27 2.6 SPAPB24D3.10c |agl1|agl|alpha-glucosidase Agl1|Schizosaccharomyc... 25 7.9 >SPAC19E9.03 |pas1|SPAC57A10.01|cyclin Pas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 31.1 bits (67), Expect = 0.12 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +3 Query: 414 NYVAAAAPSELFLVSLMVGNKFLQDDGEDDEVICSEWAASGGMELKQLKKLE 569 NY+ LFLV LM KFLQD + W+ G+ + +L LE Sbjct: 76 NYIPLLCGRRLFLVCLMAATKFLQDRSFSNRA----WSRLSGLPVDKLLVLE 123 >SPAC25A8.01c ||snf2SR|fun thirty related protein Fft3|Schizosaccharomyces pombe|chr 1|||Manual Length = 922 Score = 26.6 bits (56), Expect = 2.6 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = +2 Query: 107 NVEYIKKTTGRVKVQDQGHG*S*RVFEAHYKDPILRAAAFTSVPQP 244 N+ K T G V VQ + +F HYKD ILR A + +P Sbjct: 670 NLAKKKSTAGFVLVQLRKLADHPMLFRIHYKDDILRQMAKAIMNEP 715 >SPBC354.14c |vac8||vacuolar protein Vac8|Schizosaccharomyces pombe|chr 2|||Manual Length = 550 Score = 26.6 bits (56), Expect = 2.6 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 39 ICNVNVPREKHLTIRIKINRAIIMSNISKRRREGSR 146 ICNV +P ++I ++ N A + N+S + SR Sbjct: 418 ICNVLIPLTDSMSIEVQGNSAAALGNLSSNVDDYSR 453 >SPAPB24D3.10c |agl1|agl|alpha-glucosidase Agl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 969 Score = 25.0 bits (52), Expect = 7.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 462 MVGNKFLQDDGEDDEVICSEWAASG 536 MVG G+ DE +CS W A G Sbjct: 672 MVGADVCGFLGDSDEELCSRWMAMG 696 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,322,643 Number of Sequences: 5004 Number of extensions: 46108 Number of successful extensions: 111 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -