BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30023 (527 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.41 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 25 0.41 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 21 6.7 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 6.7 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 21 8.9 AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory recept... 21 8.9 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.0 bits (52), Expect = 0.41 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 360 LRDENGKPKIADEELQAVTNCTLTNALKQLASLVLLAEDIFSELTEQLQEITI 518 L ++N +P + DE L VT+ KQ+ + +IFS++ E+ Q + I Sbjct: 40 LSEQNNQP-VHDEHLFIVTHQAYELWFKQIIYELDSIRNIFSDVLEESQTLEI 91 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 25.0 bits (52), Expect = 0.41 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = +3 Query: 360 LRDENGKPKIADEELQAVTNCTLTNALKQLASLVLLAEDIFSELTEQLQEITI 518 L ++N +P + DE L VT+ KQ+ + +IFS++ E+ Q + I Sbjct: 40 LSEQNNQP-VHDEHLFIVTHQAYELWFKQIIYELDSIRNIFSDVLEESQTLEI 91 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.0 bits (42), Expect = 6.7 Identities = 6/20 (30%), Positives = 13/20 (65%) Frame = -2 Query: 271 RTAKLNVIPTSIQHIITKNV 212 +T +++PT + HI +N+ Sbjct: 152 KTTSKSLVPTPVTHIFLQNL 171 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.0 bits (42), Expect = 6.7 Identities = 11/49 (22%), Positives = 26/49 (53%) Frame = -3 Query: 204 RHFELTDILTGELSLKPLFLIRHAVQVTY*LMRKYFNSDNKFRKVSKKL 58 R FE++ + G L L ++ ++ + +++ +NKF+ + +KL Sbjct: 71 RFFEISFEILGSLDSLILLMVLVSIILGSLKTKEWAKLNNKFQYIDEKL 119 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -2 Query: 421 QLVTACNSSSAIFGFP 374 QL C + + +FGFP Sbjct: 241 QLCDMCGAINMLFGFP 256 >AM292344-1|CAL23156.1| 291|Tribolium castaneum gustatory receptor candidate 23 protein. Length = 291 Score = 20.6 bits (41), Expect = 8.9 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 76 SELII*VKIFSHQLIRNLNCMSY 144 S + I + H LIR NC+ Y Sbjct: 128 SGIFINLPFLEHNLIRLKNCVIY 150 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,914 Number of Sequences: 336 Number of extensions: 2570 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12782794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -