BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30009 (451 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024809-10|AAF59547.1| 272|Caenorhabditis elegans Hypothetical... 28 2.7 Z19157-4|CAA79570.1| 1474|Caenorhabditis elegans Hypothetical pr... 28 3.6 U58750-13|AAB00653.1| 616|Caenorhabditis elegans Hypothetical p... 27 8.3 EF378622-1|ABN54457.1| 1492|Caenorhabditis elegans enhancer of g... 27 8.3 AL117201-3|CAL64007.1| 1512|Caenorhabditis elegans Hypothetical ... 27 8.3 >AC024809-10|AAF59547.1| 272|Caenorhabditis elegans Hypothetical protein Y53G8AR.1 protein. Length = 272 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = -2 Query: 180 PGSGCDPWRYPRVD--CAIVPASPTAGTT 100 PGS CDP RY +D C++ P + T TT Sbjct: 179 PGSACDPDRY-NIDGLCSLNPPTTTTTTT 206 >Z19157-4|CAA79570.1| 1474|Caenorhabditis elegans Hypothetical protein ZC84.6 protein. Length = 1474 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = +1 Query: 229 CTTKQVCTKVGGIQ-RACLDPTLPYCNLGECSATPAEGCEP 348 CT T G Q A +D ++ YC G+ T ++GC P Sbjct: 890 CTIGHFVTCPAGFQCMAQIDGSMGYCCKGQPQLTASDGCPP 930 >U58750-13|AAB00653.1| 616|Caenorhabditis elegans Hypothetical protein F55G1.13 protein. Length = 616 Score = 26.6 bits (56), Expect = 8.3 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -3 Query: 287 GSRHALCIPPTFVQTCLVVQSRQVLPMVVHGAHCGYQGADAIHGGIQGLT 138 GS + +C P F ++CL S +++ +++ + G G D + Q LT Sbjct: 509 GSYYCVCSPNMFGKSCLFSNSDKIIYQILNATY-GDLGPDKLDEMAQELT 557 >EF378622-1|ABN54457.1| 1492|Caenorhabditis elegans enhancer of glp-1 protein. Length = 1492 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 230 QSRQVLPMVVHGAHCGYQGADAIHGGIQG 144 Q Q GAH G QGA H G QG Sbjct: 1004 QGEQFGAQGAQGAHFGAQGAQGAHFGAQG 1032 >AL117201-3|CAL64007.1| 1512|Caenorhabditis elegans Hypothetical protein Y53H1C.2a protein. Length = 1512 Score = 26.6 bits (56), Expect = 8.3 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = -3 Query: 230 QSRQVLPMVVHGAHCGYQGADAIHGGIQG 144 Q Q GAH G QGA H G QG Sbjct: 1024 QGEQFGAQGAQGAHFGAQGAQGAHFGAQG 1052 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,409,888 Number of Sequences: 27780 Number of extensions: 213495 Number of successful extensions: 538 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 538 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -