BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30006 (676 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g66656.1 68416.m00780 MADS-box family protein contains Pfam p... 31 0.70 At3g27190.1 68416.m03400 uracil phosphoribosyltransferase, putat... 29 2.8 >At3g66656.1 68416.m00780 MADS-box family protein contains Pfam profile: PF00319 SRF-type transcription factor (DNA-binding and dimerisation domain) Length = 178 Score = 31.1 bits (67), Expect = 0.70 Identities = 13/50 (26%), Positives = 24/50 (48%) Frame = +1 Query: 343 NCIKLGWYGNVMKRNDNEICKRVLTMNVEGYTRRR*GRPKKKWMDCVEDD 492 +C G+ R + +ICKR+ ++ E ++ G KW++ E D Sbjct: 81 SCETSGYSRGNRARQEKKICKRLNSITEEAEAEKKHGEDLHKWLESAEQD 130 >At3g27190.1 68416.m03400 uracil phosphoribosyltransferase, putative / UMP pyrophosphorylase, putative / UPRTase, putative similar to SP|O65583 Uracil phosphoribosyltransferase (EC 2.4.2.9) (UMP pyrophosphorylase) (UPRTase) {Arabidopsis thaliana}; contains Pfam profile PF00485: Phosphoribulokinase / Uridine kinase family Length = 483 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = -3 Query: 509 DTHEHISSSTQSIHFFLGLPHLLRV*PSTFIVSTLLQI 396 D H + Q IH LG L ++ P+ F++ T QI Sbjct: 247 DNHVAVDLIVQHIHTKLGQHDLCKIYPNVFVIETTFQI 284 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,351,705 Number of Sequences: 28952 Number of extensions: 331576 Number of successful extensions: 744 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1432596384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -