BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30003 (687 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) 286 1e-77 SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) 136 2e-32 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.031 SB_22016| Best HMM Match : HSP90 (HMM E-Value=0) 35 0.071 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 32 0.38 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.50 SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) 31 0.66 SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.66 SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) 31 0.66 SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_35415| Best HMM Match : BRF1 (HMM E-Value=4.4) 30 1.5 SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) 30 1.5 SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) 30 2.0 SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) 29 2.7 SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) 29 2.7 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 29 2.7 SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) 29 2.7 SB_33613| Best HMM Match : PAS (HMM E-Value=0.0083) 29 2.7 SB_28851| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.7 SB_45590| Best HMM Match : Syntaxin (HMM E-Value=0.61) 29 3.5 SB_23704| Best HMM Match : Utp14 (HMM E-Value=2.1e-10) 29 3.5 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 29 4.7 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.7 SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) 28 6.2 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_18961| Best HMM Match : zf-U1 (HMM E-Value=0.07) 28 6.2 SB_57348| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) 28 6.2 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.1 >SB_12441| Best HMM Match : Ribosomal_L18p (HMM E-Value=0) Length = 328 Score = 286 bits (702), Expect = 1e-77 Identities = 138/217 (63%), Positives = 168/217 (77%) Frame = -2 Query: 680 VCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXXXXXXDEYNVEP 501 + +AY+HELP +GVKVGLTNYAAAY TG DEYNVE Sbjct: 107 LASAYAHELPNFGVKVGLTNYAAAYCTGLLLARRLLTMLNLHEIYTGTDDVNGDEYNVES 166 Query: 500 VDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPHSIKRFPGYDAESKKFNAEV 321 VD PGAFRC+LDVGLART+TGARVFGA+KGAVDGGL +PHS+KRFPGYD+ESK F+AEV Sbjct: 167 VDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPHSMKRFPGYDSESKDFSAEV 226 Query: 320 HRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHK 141 HR HIFG HVAEYMRSL ++DE+S+KRQFS YIK GV AD+IE IYK AH+AIRADP HK Sbjct: 227 HRNHIFGKHVAEYMRSLAEEDEESYKRQFSAYIKNGVDADSIEGIYKAAHQAIRADPVHK 286 Query: 140 KKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIK 30 K E KKD V+ KR++++K++ +R +R+KQKKA+F++ Sbjct: 287 KAE-KKD-VQLKRFHRKKMSRQQRVDRVKQKKAAFLR 321 >SB_35225| Best HMM Match : Ribosomal_L18p (HMM E-Value=4e-30) Length = 113 Score = 136 bits (329), Expect = 2e-32 Identities = 64/101 (63%), Positives = 71/101 (70%) Frame = -2 Query: 680 VCAAYSHELPRYGVKVGLTNYAAAYSTGXXXXXXXXXXXXXXXXXXXXXXXXXDEYNVEP 501 +CAAY+HELPRYGVKVGLTNYAAAY TG DEYNVE Sbjct: 12 ICAAYAHELPRYGVKVGLTNYAAAYCTGLLLARRLLTKLNLHEIYTGTEEVNGDEYNVES 71 Query: 500 VDNGPGAFRCYLDVGLARTTTGARVFGAMKGAVDGGLNVPH 378 +D PGAFRC+LDVGLART+TGARVFGA+KGAVDGGL +PH Sbjct: 72 IDGSPGAFRCFLDVGLARTSTGARVFGALKGAVDGGLEIPH 112 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 36.3 bits (80), Expect = 0.023 Identities = 21/64 (32%), Positives = 36/64 (56%) Frame = -2 Query: 200 AIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQ 21 A EA+Y +A P+ KKK+ KK K+K+ K+K ++K + K+KK K+ + Sbjct: 135 AAEALY----QAFPQPPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKK 190 Query: 20 DQAE 9 ++ E Sbjct: 191 EEEE 194 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = -2 Query: 206 ADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKR 27 A+A+ + + + KKK+ KK K+K+ K+K ++K + K+KK + Sbjct: 136 AEALYQAFPQPPTKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEE 195 Query: 26 LQDQAE 9 +++ E Sbjct: 196 EEEEEE 201 Score = 28.7 bits (61), Expect = 4.7 Identities = 14/45 (31%), Positives = 26/45 (57%) Frame = -2 Query: 143 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQAE 9 KKK+ KK K+K+ K+K ++K + K+KK + +++ E Sbjct: 158 KKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKEEEEEEEEEEEE 202 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 35.9 bits (79), Expect = 0.031 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 4/96 (4%) Frame = -2 Query: 281 MRSLEQDDEDSFKRQFSKYI----KLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSV 114 ++ EQ ++ FK++ + Y+ K G T D IE KK H D HK+ KK Sbjct: 345 VKFFEQKQKEEFKKEETDYLDVFKKGGTTKDKIEKKDKKKHHKKHKDKEHKEHHHKKKRS 404 Query: 113 KQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQAEA 6 K + +K+ K K + ++ + + EA Sbjct: 405 HSKTSSTTDEEKERKKSETKNKDSEDEEKERKKREA 440 >SB_22016| Best HMM Match : HSP90 (HMM E-Value=0) Length = 581 Score = 34.7 bits (76), Expect = 0.071 Identities = 21/87 (24%), Positives = 45/87 (51%), Gaps = 2/87 (2%) Frame = -2 Query: 269 EQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELK--KDSVKQKRWN 96 +QD+ F QF K +KLG+ D++ K + +R S EL KD V + + N Sbjct: 361 DQDNYKKFYEQFGKNLKLGIHEDSVNR--AKLADLLRYHSSSSGDELTSLKDYVTRMKEN 418 Query: 95 KRKLTLAERKNRIKQKKASFIKRLQDQ 15 ++ + +++ + ++F++R++ + Sbjct: 419 QKDIYFITGESKDQVSHSAFVERVKSR 445 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 32.3 bits (70), Expect = 0.38 Identities = 24/78 (30%), Positives = 39/78 (50%) Frame = -2 Query: 278 RSLEQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRW 99 ++L Q +E +R +K K + +EA KK E + +KKE K+ K++R Sbjct: 320 KALRQKEEKEKQRLEAKAAK---EKERLEAKQKKEQERLEKQAEKEKKE-KERLEKKQRE 375 Query: 98 NKRKLTLAERKNRIKQKK 45 K +L E+K K+KK Sbjct: 376 EKDRLEKKEKKEEEKRKK 393 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.9 bits (69), Expect = 0.50 Identities = 16/49 (32%), Positives = 28/49 (57%) Frame = -2 Query: 161 RADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQ 15 R + KKK+ KK K+K+ K+K +KN+ K KK +K+ +++ Sbjct: 14 REEKKRKKKKQKKKKKKKKK-KKKKKNKKNKKNKNKNKKKKKMKKKKEE 61 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = -2 Query: 185 YKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 45 Y++ + + KKK+ KK K+ + NK+ ++K ++K+KK Sbjct: 13 YREEKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKK 59 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/52 (26%), Positives = 27/52 (51%) Frame = -2 Query: 164 IRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQAE 9 +R + +KK KK K+K+ K+K +KN+ + K K+++ + E Sbjct: 9 MRREYREEKKRKKKKQKKKKKKKKKKKKKKNKKNKKNKNKNKKKKKMKKKKE 60 >SB_37866| Best HMM Match : CDC37 (HMM E-Value=0.81) Length = 461 Score = 31.5 bits (68), Expect = 0.66 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 4/88 (4%) Frame = -2 Query: 281 MRSLEQDDEDSFKRQFSKYIKLGVTADAIEA--IYK--KAHEAIRADPSHKKKELKKDSV 114 M+ + +DS KR+ + GV I+ + K +AH+ A P +KKK KK+ Sbjct: 255 MKKGSKQAKDSAKRKTTVVTSAGVIKKPIKLAKVMKMIRAHKLTPAKPVNKKKNDKKEQT 314 Query: 113 KQKRWNKRKLTLAERKNRIKQKKASFIK 30 +QK K K+ + K++ K K +K Sbjct: 315 QQKE-KKNKIN-NDVKSKSKSKIVKILK 340 >SB_36664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 31.5 bits (68), Expect = 0.66 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 1/88 (1%) Frame = -2 Query: 269 EQDDEDSFKRQFSKYIKLGVTADAIEAIYKKAH-EAIRADPSHKKKELKKDSVKQKRWNK 93 E +DE+ ++Q K + +A + K + I A H K E +K++ KQ+ K Sbjct: 255 EDEDENEVEKQEEFERKYNFRFEEPDAAFIKTYPRTISASVRH-KDERRKEARKQREERK 313 Query: 92 RKLTLAERKNRIKQKKASFIKRLQDQAE 9 +K +++ IK+ K K +QD+ E Sbjct: 314 KK-EKEQKREEIKRMKNLKRKEIQDKLE 340 >SB_47629| Best HMM Match : Vicilin_N (HMM E-Value=1.1) Length = 599 Score = 31.5 bits (68), Expect = 0.66 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = -2 Query: 143 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQAEA 6 +KKE KK+ K+++ K+K ERK K+++ K+ D E+ Sbjct: 48 RKKERKKERKKERKKEKKKERKKERKEERKKERKKAEKKFTDSNES 93 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/72 (26%), Positives = 32/72 (44%) Frame = -2 Query: 251 SFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAE 72 S ++S + G D E +K + +KKE KK+ K+K+ ++K E Sbjct: 16 SIDGRWSSKTRKGGKRDEREQEREKKERRKKERKKERKKERKKERKKEKKKERKKERKEE 75 Query: 71 RKNRIKQKKASF 36 RK K+ + F Sbjct: 76 RKKERKKAEKKF 87 Score = 28.3 bits (60), Expect = 6.2 Identities = 14/50 (28%), Positives = 26/50 (52%) Frame = -2 Query: 170 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQ 21 E R +KKE KK+ K+++ ++K ERK K+++ K+ + Sbjct: 35 EQEREKKERRKKERKKERKKERKKERKKEKKKERKKERKEERKKERKKAE 84 >SB_4647| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2735 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = -2 Query: 191 AIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 45 A +K + R H+ K K++SVK KR KRK +RK++ K K Sbjct: 204 AKHKHKRKRKRESAKHRLKR-KRESVKHKRKQKRKSAKHKRKHKRKSDK 251 >SB_35415| Best HMM Match : BRF1 (HMM E-Value=4.4) Length = 408 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 209 TADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTL 78 T D + + K+ EA + K+ ++D ++K+WNKR+ L Sbjct: 38 TEDRMNHLMKQKTEAAKKQRISNKQARQEDQEERKKWNKRQAVL 81 >SB_34899| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00019) Length = 1136 Score = 30.3 bits (65), Expect = 1.5 Identities = 20/79 (25%), Positives = 38/79 (48%), Gaps = 4/79 (5%) Frame = -2 Query: 233 SKYIKLGVTADAIEAIYKKAHEAIR-ADPSHKKKELKKDSVKQKR---WNKRKLTLAERK 66 S+Y + D +E + EA+R + +H++ K S ++R W K+K + E Sbjct: 397 SEYSRTTERVDHLEDVLANKEEALRNSQDAHEQTVAKLSSAIKERETSWKKQKAEIEEHY 456 Query: 65 NRIKQKKASFIKRLQDQAE 9 N+I + K+ Q+ A+ Sbjct: 457 NKIINDLQNRTKKTQNLAD 475 >SB_24813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1218 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 1/95 (1%) Frame = -2 Query: 287 EYMRSLEQDDEDSFKRQFSKYIKLG-VTADAIEAIYKKAHEAIRADPSHKKKELKKDSVK 111 EY R Q +E F R+ + + G V A ++ Y + + + K KEL+K+ K Sbjct: 282 EYAREKAQLEESYF-REKEDFQRSGLVQASEVKESYNREKQELEESYKQKIKELQKNFAK 340 Query: 110 QKRWNKRKLTLAERKNRIKQKKASFIKRLQDQAEA 6 +K+ + + E++N + + F ++++ + EA Sbjct: 341 EKQEIEDEYA-HEKENIRAELENEFSEKIKSENEA 374 >SB_56509| Best HMM Match : Ebp2 (HMM E-Value=2.1) Length = 298 Score = 29.9 bits (64), Expect = 2.0 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -2 Query: 353 DAESKKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIK 219 D+ K+ NAE+ RA +++ ++S D+E + R+F + K Sbjct: 157 DSSVKRGNAEIRRARFRATTISQVVQSFRSDEERNSVRKFIAHYK 201 >SB_50387| Best HMM Match : HLH (HMM E-Value=8.2e-05) Length = 791 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 388 LRPPSTAPFIAPKTRAPVVVRAKPTSK*HLNAPGPLST 501 +RP PF+ P +RAP A PT+ P P S+ Sbjct: 356 MRPAHIGPFLYPDSRAPFSPLASPTASSDSGHPSPGSS 393 >SB_46988| Best HMM Match : HEAT (HMM E-Value=8.6e-06) Length = 1231 Score = 29.5 bits (63), Expect = 2.7 Identities = 16/62 (25%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = -2 Query: 188 IYKKAHEAIRADPSHKKKELKKDSVKQKRWN-KRKLTLAERKNRIKQKKASFIKRLQDQA 12 +YKK IR + KKE ++ ++QK+ +R+ AE + ++K+ ++L+ + Sbjct: 1135 VYKKGEVLIRELDGYNKKERAREKMRQKQLRLQREREEAEHQEAERKKEEEAKQKLKQKE 1194 Query: 11 EA 6 +A Sbjct: 1195 DA 1196 Score = 27.9 bits (59), Expect = 8.1 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 188 IYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQ 51 + ++ EA + KK+E K +KQK ++KL ER+ +Q Sbjct: 1166 LQREREEAEHQEAERKKEEEAKQKLKQKEDARKKLEEVERRKSQQQ 1211 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 29.5 bits (63), Expect = 2.7 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 6/90 (6%) Frame = -2 Query: 293 VAEYMRSLEQDDEDSFKRQFSKYIKL------GVTADAIEAIYKKAHEAIRADPSHKKKE 132 VA++ ++ + K++F K +KL +++D I+ + A+ H+ +E Sbjct: 545 VAQFSCCEVEEAWEELKQKFFKAVKLFGEDPKNLSSDQFFGIFNVFLVSF-AEAKHQNEE 603 Query: 131 LKKDSVKQKRWNKRKLTLAERKNRIKQKKA 42 +KK ++R KR+ LAE+K R +QK A Sbjct: 604 IKKKKEAEER--KRR-ALAEQKERDRQKSA 630 >SB_12151| Best HMM Match : AAA_5 (HMM E-Value=0.00042) Length = 4607 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 128 KKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQD 18 +KD + RW+KR +L + K R+K+K + L D Sbjct: 709 EKDLSLRSRWSKRVHSLIDEKTRVKEKLRKLNRILND 745 >SB_33613| Best HMM Match : PAS (HMM E-Value=0.0083) Length = 624 Score = 29.5 bits (63), Expect = 2.7 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +1 Query: 388 LRPPSTAPFIAPKTRAPVVVRAKPTSK*HLNAPGPLST 501 +RP PF+ P +RAP A PT+ P P S+ Sbjct: 222 MRPAHIGPFLYPDSRAPFSPLASPTASSDSGHPSPGSS 259 >SB_28851| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 29.5 bits (63), Expect = 2.7 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 155 DPSHKKKELKKDSVKQKRWNKRK-LTLAERKNRIKQKKA 42 + S KKELK D+ K+ NKRK + +E K KKA Sbjct: 129 ETSESKKELKSDTKSVKKANKRKTMNESESTKTKKPKKA 167 >SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 29.5 bits (63), Expect = 2.7 Identities = 13/44 (29%), Positives = 24/44 (54%) Frame = -2 Query: 209 TADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTL 78 T D + + K+ EA + K+ ++D ++K+WNKR+ L Sbjct: 712 TEDRMNHLMKQKTEAAKKQRICNKQARQEDQEERKKWNKRQAVL 755 >SB_45590| Best HMM Match : Syntaxin (HMM E-Value=0.61) Length = 315 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = -2 Query: 209 TADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAE 72 T DAI+A K+ +E D + K +K K + W + ++ LA+ Sbjct: 232 TCDAIKAYLKQVYEEEFYDDIEQSKPIKDPKSKDQLWTEVEMILAQ 277 >SB_23704| Best HMM Match : Utp14 (HMM E-Value=2.1e-10) Length = 574 Score = 29.1 bits (62), Expect = 3.5 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = -2 Query: 269 EQDDEDSFKRQFSKYIKLGV--TADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWN 96 E+DD+D F+ Q +K G T + K A E A P+ K+KE KK K+K + Sbjct: 348 EKDDDDDFELQLAKPEPEGKKGTKRGKKKTSKDATEESEA-PNKKRKEKKKKKKKKKASS 406 Query: 95 K 93 K Sbjct: 407 K 407 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 28.7 bits (61), Expect = 4.7 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = -2 Query: 233 SKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIK 54 S++I L D + + KKAH + P E ++ K+ KR LAE RI+ Sbjct: 16 SQHITLSNPPDVKKTLQKKAHHSKVVHPKKHHSEENDETDKEHVRRKRHPDLAEMLRRIQ 75 Query: 53 Q 51 + Sbjct: 76 R 76 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 28.7 bits (61), Expect = 4.7 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 1/93 (1%) Frame = -2 Query: 290 AEYMRSLE-QDDEDSFKRQFSKYIKLGVTADAIEAIYKKAHEAIRADPSHKKKELKKDSV 114 +E SL+ +D D S +L + + + +K IR PS +++ L K Sbjct: 3097 SELSPSLDIKDMRDKLTHCESLVCELNTQKEYVNQLSEKVKSIIRVSPSQRRENLDKLKN 3156 Query: 113 KQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQ 15 W K+ + LA +KKA +K +Q Q Sbjct: 3157 VADLW-KKAIRLA------NEKKADLVKGIQQQ 3182 >SB_53951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 143 KKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 45 KKK+ KK K+K+ NK+K+ E K ++++ Sbjct: 115 KKKKKKKKKKKKKKINKKKINKVEEKEEGEEEE 147 >SB_35419| Best HMM Match : SMC_C (HMM E-Value=1.9e-05) Length = 867 Score = 28.3 bits (60), Expect = 6.2 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = -2 Query: 170 EAIRADPSHKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKKASFIKRLQDQAEA 6 EAI+ H+K+ELKK K+K K++ T+ E K + + ++Q+ +A Sbjct: 549 EAIKE--KHQKQELKKQRFKEKMEKKQEETMVEILT-AKNNRKHYSDKVQENKDA 600 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 28.3 bits (60), Expect = 6.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -2 Query: 146 HKKKELKKDSVKQKRWNKRKLTLAERKNRIKQKK 45 HK K+ K++ K++R + K +ERK ++KK Sbjct: 191 HKDKKKKREESKERRRHSDKAEKSERKREKEEKK 224 >SB_18961| Best HMM Match : zf-U1 (HMM E-Value=0.07) Length = 844 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -1 Query: 222 KTRSHCRCY*SHLQESP*SHPCGSIPQEERVKERLGQTEALEQTQANIGREEKQ 61 K R H + Y ++ + P S+ I + + + + LGQ+E E + EEK+ Sbjct: 611 KARKHQKNYRQYVIDHP-SYEANQIKRNKELSDMLGQSEGQEMLLYEVEDEEKR 663 >SB_57348| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 28.3 bits (60), Expect = 6.2 Identities = 27/111 (24%), Positives = 49/111 (44%), Gaps = 4/111 (3%) Frame = -2 Query: 362 PGYDAES-KKFNAEVHRAHIFGLHVAEYMRSLEQDDEDSFKRQFSKYIKLG-VTADAIEA 189 P D++S KK + ++ I + +S ++ D+ S KR K++K + + A Sbjct: 168 PCCDSKSTKKPSKSSKKSEIAKSEKHKSAKSHDKKDK-SPKRHEEKHVKKSSIPTKKVVA 226 Query: 188 IYKKAHEAIRADPSHKK--KELKKDSVKQKRWNKRKLTLAERKNRIKQKKA 42 + KKA + D +HK + K K +K K+ + + K K A Sbjct: 227 VVKKAKSNTKKDSAHKPVISKSPKPKAMSKTKSKHKIAKKGKSGKAKDKAA 277 >SB_29906| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2463 Score = 28.3 bits (60), Expect = 6.2 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 3/36 (8%) Frame = -1 Query: 144 QEERVKERLGQTEALEQTQANI---GREEKQNQAKE 46 QEE + E+ GQ + LEQT+ + G +KQ +KE Sbjct: 2250 QEEELDEQAGQIQILEQTKLRLEMAGERDKQLISKE 2285 >SB_8083| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) Length = 3445 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +1 Query: 343 DSAS*PGNLLME*GTLRPPSTAPFIAPKTRAPV 441 D+ P +M T+RPP T F+ T+APV Sbjct: 1653 DTTVAPETTVMPDTTMRPPKTDVFVTEATKAPV 1685 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 27.9 bits (59), Expect = 8.1 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 6/59 (10%) Frame = -2 Query: 203 DAIEAIYKKAHEAI--RADPSHKKKELKKDSVKQKRWNK---RKLT-LAERKNRIKQKK 45 + IEA+ K+A I R + K +E +K +QKR ++ R+L +AE KNR +Q K Sbjct: 1209 ERIEALNKEADLLIQRRKEAERKAEEKRKQIERQKRIDEEVERRLQKIAEEKNREEQLK 1267 >SB_21831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 27.9 bits (59), Expect = 8.1 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 8/37 (21%) Frame = +1 Query: 49 FCLILFFLSAN--------VSLRLFQRFCLTESFFNS 135 FCL +FF+S + S+RLF+ FC+T S F S Sbjct: 242 FCLSIFFISKDKKEEVLHFFSIRLFKVFCVTLSGFTS 278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,864,418 Number of Sequences: 59808 Number of extensions: 399415 Number of successful extensions: 1639 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1579 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1781448916 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -