SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30596
         (698 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_01_0009 + 68825-68950,72571-72669,72841-72929,74971-75087,757...    30   1.5  

>08_01_0009 +
           68825-68950,72571-72669,72841-72929,74971-75087,
           75747-75906,76419-76549,76810-76906,77584-77877
          Length = 370

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
 Frame = -1

Query: 368 FKYSASIFSCFRHFSAPYNFSIK--FCHYQTFVVIKASEIHFIFDLRGMLIFNNKLS 204
           FKYS  + +  + F   YNF I    CHY + +V   ++   +  + G+L+F   +S
Sbjct: 123 FKYS-KLLASLQTFRCTYNFEISFSLCHYGSLMVNACTKECSLEGVAGLLLFAGSVS 178


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,111,386
Number of Sequences: 37544
Number of extensions: 211412
Number of successful extensions: 328
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 326
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 328
length of database: 14,793,348
effective HSP length: 80
effective length of database: 11,789,828
effective search space used: 1792053856
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -