BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= heS30596
(698 letters)
Database: fruitfly
53,049 sequences; 24,988,368 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AE014297-2766|AAN13823.2| 386|Drosophila melanogaster CG31208-P... 31 1.1
>AE014297-2766|AAN13823.2| 386|Drosophila melanogaster CG31208-PA
protein.
Length = 386
Score = 31.5 bits (68), Expect = 1.1
Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
Frame = -1
Query: 281 FVVIKASEIHFIFDLRGMLIFNNKLSVRNENSYTGLR-NANEEKSIGAKLCLKRIQNRVS 105
F ++ A+ I + G L S N+ YT LR + + G+K ++R+QNR+
Sbjct: 178 FYLVSATNIFIHINSIGYLSLGVLYSELNKYVYTNLRIQLQKLNTSGSKQKIRRVQNRLE 237
Query: 104 QCL 96
+C+
Sbjct: 238 KCI 240
Database: fruitfly
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 24,988,368
Number of sequences in database: 53,049
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,496,879
Number of Sequences: 53049
Number of extensions: 397706
Number of successful extensions: 758
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 742
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 758
length of database: 24,988,368
effective HSP length: 83
effective length of database: 20,585,301
effective search space used: 3067209849
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -