BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30545 (584 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 26 1.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 26 1.0 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 25 1.4 AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsiv... 25 2.4 AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 25 2.4 AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. 24 3.2 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 4.2 AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 23 5.5 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 23 5.5 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 23 5.5 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 23 7.3 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 23 7.3 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 23 9.6 DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 23 9.6 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 23 9.6 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 23 9.6 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 23 9.6 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 23 9.6 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQR 415 QR PQR+ QQ +Q H Q+Q+ Sbjct: 354 QRQPQRYVVAGSSQQQQQQHQQQQQK 379 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 25.8 bits (54), Expect = 1.0 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +2 Query: 323 LRHRCQRYPQRFRYREVHQQGEQDHHYQRQRS 418 L+ + Q+ Q+ + + HQQ + HH+Q Q S Sbjct: 1308 LQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLS 1339 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.4 bits (53), Expect = 1.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = +3 Query: 405 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQ 503 N++ R +EE ++M NE+ K + QK+ Q Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQ 236 >AY496420-1|AAS80137.1| 447|Anopheles gambiae bacteria responsive protein 1 protein. Length = 447 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 225 G*ACYDQR*QLLGKFELTGIPPAPRGVP 308 G A Y + +L+G +TG+PP P P Sbjct: 303 GIATYGRGWRLVGDSGITGVPPIPADGP 330 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 24.6 bits (51), Expect = 2.4 Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Frame = +3 Query: 294 PRGVPQIEVTFDIDANGILNVSAIEK---STNKENKITITNDKGRLSKEEIERMVNEAEK 464 P+G + ++ + ++GIL ++ K N+E I IT+ G+ K+ + E Sbjct: 65 PKGHNEADIVSSLSSDGILTITCPRKEIEQKNEERSIPITH-TGQPMKQVTGKAAPENGH 123 Query: 465 YRNEDDKQK 491 + E +K + Sbjct: 124 SKKEGEKME 132 >AJ535203-1|CAD59403.1| 1229|Anopheles gambiae SMC1 protein protein. Length = 1229 Score = 24.2 bits (50), Expect = 3.2 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +3 Query: 351 NVSAIEKSTNKENKITITNDKGRLSKEEIERMVNEAEKYRNE 476 N+ A++K KI TN++ ++++ ++ EK +NE Sbjct: 1024 NMKAMQKLDRVTEKIQSTNEEFEAARKKAKKAKAAFEKVKNE 1065 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 4.2 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 294 PRGVPQIEVTFDIDANGILNVSAIEKSTNKE--NKITITNDKGRLS 425 P G + T+D+ +G+LN A+ N + I I D G L+ Sbjct: 255 PDGFMALVDTYDVKRSGLLNFCAVALGLNDQGYRAIGIRIDSGDLA 300 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 5.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 23.4 bits (48), Expect = 5.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 189 QRQPQQFQQQQRQPQYLQPQQAQRQQEEL 217 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.4 bits (48), Expect = 5.5 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRQPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRPPQQFQQQQRQPQYLQPQQLQRQQEEL 216 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.0 bits (47), Expect = 7.3 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ F+ ++ Q Q QRQ+ L Sbjct: 260 QRQPQEFQQQQRQPQYLQPQQSQRQQEEL 288 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 22.6 bits (46), Expect = 9.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +2 Query: 377 QQGEQDHHYQRQR 415 QQ Q HH+Q QR Sbjct: 110 QQQHQQHHHQHQR 122 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 22.6 bits (46), Expect = 9.6 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +2 Query: 362 YREVHQQGEQDHHYQRQR 415 YR+ HQQ +Q Q+Q+ Sbjct: 898 YRQQHQQQQQQQQQQQQQ 915 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 9.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRPPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 22.6 bits (46), Expect = 9.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 188 QRPPQQFQQQQRQPQYLQPQQSQRQQEEL 216 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 22.6 bits (46), Expect = 9.6 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = +2 Query: 338 QRYPQRFRYREVHQQGEQDHHYQRQRSSL 424 QR PQ+F+ ++ Q Q QRQ+ L Sbjct: 259 QRPPQQFQQQQRQPQYLQPQQSQRQQEEL 287 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 22.6 bits (46), Expect = 9.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 359 RYREVHQQGEQDHHYQRQRSSLQ 427 R ++ HQQ +Q QRQ+ Q Sbjct: 306 RQQQQHQQQQQQQQQQRQQQQRQ 328 Score = 22.6 bits (46), Expect = 9.6 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +2 Query: 326 RHRCQRYPQRFRYREVHQQGEQDHHYQRQRS 418 + R Q+ PQ+ + + QQ Q Q+QRS Sbjct: 458 QQRQQQQPQQQQQQRPQQQRPQQQRPQQQRS 488 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 544,534 Number of Sequences: 2352 Number of extensions: 10531 Number of successful extensions: 60 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -