BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30544 (392 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4CAC3 Cluster: Putative uncharacterized protein; n=1; ... 31 7.9 UniRef50_Q54QL7 Cluster: Putative uncharacterized protein; n=2; ... 27 8.1 >UniRef50_A4CAC3 Cluster: Putative uncharacterized protein; n=1; Pseudoalteromonas tunicata D2|Rep: Putative uncharacterized protein - Pseudoalteromonas tunicata D2 Length = 181 Score = 31.1 bits (67), Expect = 7.9 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -3 Query: 285 NSGLDSLGLDFPVIYIINEEMLIYYVQVFYFFNS 184 N GL S G+D+ + INE+ IY +F +F+S Sbjct: 125 NGGLRSFGIDYSYRHNINEDWQIYGEALFEYFSS 158 >UniRef50_Q54QL7 Cluster: Putative uncharacterized protein; n=2; Eukaryota|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1218 Score = 27.5 bits (58), Expect(2) = 8.1 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +1 Query: 151 VLVKSPLYYLTRVEKIEYLYIIN*HFFINNVDYWKI*AKAVQTTVLFWF 297 VL Y++ E I ++ HF NN+DY + K L WF Sbjct: 25 VLFNLIFYFIENDETINQNHLFYQHFITNNLDYSDLRIKFKNLKNLNWF 73 Score = 22.2 bits (45), Expect(2) = 8.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +1 Query: 28 FNKAQSNCGYVIIEEKKLFELLF 96 FN N + +I K LF L+F Sbjct: 9 FNNENQNIFWKVIHNKVLFNLIF 31 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 278,162,088 Number of Sequences: 1657284 Number of extensions: 3956693 Number of successful extensions: 7908 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7907 length of database: 575,637,011 effective HSP length: 92 effective length of database: 423,166,883 effective search space used: 16080341554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -