BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30544 (392 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 25 1.3 AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. 23 4.0 AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine pr... 23 4.0 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 22 7.0 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 22 7.0 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 22 7.0 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 24.6 bits (51), Expect = 1.3 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +3 Query: 285 FILVSLVWTYNKNTYVQIQIKFNSQNIFDV 374 FI + + Y +N + QIQ N +FD+ Sbjct: 656 FIALEKIQQYERNCHTQIQTPENVPRLFDL 685 >AJ420785-3|CAD12783.1| 380|Anopheles gambiae serpin protein. Length = 380 Score = 23.0 bits (47), Expect = 4.0 Identities = 5/18 (27%), Positives = 13/18 (72%) Frame = -3 Query: 261 LDFPVIYIINEEMLIYYV 208 +D P +Y++ + ++Y+V Sbjct: 355 VDHPFLYVLRHQQMVYFV 372 >AJ271353-1|CAB69785.1| 380|Anopheles gambiae putative serine protease inhibitor protein. Length = 380 Score = 23.0 bits (47), Expect = 4.0 Identities = 5/18 (27%), Positives = 13/18 (72%) Frame = -3 Query: 261 LDFPVIYIINEEMLIYYV 208 +D P +Y++ + ++Y+V Sbjct: 355 VDHPFLYVLRHQQMVYFV 372 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.2 bits (45), Expect = 7.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 274 GQPWPRFSSNLH 239 G PWPR++ +H Sbjct: 589 GNPWPRWTGVMH 600 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.2 bits (45), Expect = 7.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 274 GQPWPRFSSNLH 239 G PWPR++ +H Sbjct: 589 GNPWPRWTGVMH 600 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 22.2 bits (45), Expect = 7.0 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -2 Query: 274 GQPWPRFSSNLH 239 G PWPR++ +H Sbjct: 475 GNPWPRWTGVMH 486 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 286,744 Number of Sequences: 2352 Number of extensions: 4473 Number of successful extensions: 9 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 30784536 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -