BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30538 (732 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcript... 24 5.6 AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein prot... 23 7.4 AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein pr... 23 9.7 >AB090822-2|BAC57920.1| 1173|Anopheles gambiae reverse transcriptase protein. Length = 1173 Score = 23.8 bits (49), Expect = 5.6 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -3 Query: 436 PERHRCQRPSSRWRLRLPQAGQILDI 359 PER RP R R +PQ +++++ Sbjct: 1108 PERREQVRPQRRIRQHMPQQKEVVEL 1133 >AJ302656-1|CAC35521.1| 385|Anopheles gambiae gSG1b protein protein. Length = 385 Score = 23.4 bits (48), Expect = 7.4 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 282 TKPANWSLSCT 250 T PA+WS SCT Sbjct: 47 TAPADWSASCT 57 >AF387862-2|AAL56548.1| 942|Anopheles gambiae pol polyprotein protein. Length = 942 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/41 (24%), Positives = 18/41 (43%) Frame = +3 Query: 84 TVTGVAQCKIMNEDELLTTACEQFLGKTVKEIKMTVLQTLE 206 ++ G+A CK + + + L K + K + QT E Sbjct: 10 SIHGIASCKRHRDPNAIQRVAREGLAKGISIKKCDIFQTCE 50 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 718,533 Number of Sequences: 2352 Number of extensions: 14992 Number of successful extensions: 25 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74844540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -