BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30534 (634 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 2.8 AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. 21 6.5 AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia or... 21 6.5 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 2.8 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 5 PFDHITDNEIDEYRRDVERKARGERIRH*LVRIGGDKRGADD 130 P + + D D YR E K R +R L+ +GG + DD Sbjct: 69 PLNELFDVTRDNYRHITELKRRFPGLRV-LLSVGGGEDIGDD 109 >AF321227-6|AAK16426.1| 150|Tribolium castaneum Pb protein. Length = 150 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +2 Query: 206 ASAGPKPTRSGPERC*STDFLNAERAHVDSTRGDHTVNGD 325 AS P P E C T F+N++ + + ++GD Sbjct: 41 ASGAPHPAALPIEGCNETGFINSQPSMAEFMTALPHLSGD 80 >AF187068-1|AAF03888.1| 477|Tribolium castaneum proboscipedia ortholog protein. Length = 477 Score = 21.4 bits (43), Expect = 6.5 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +2 Query: 206 ASAGPKPTRSGPERC*STDFLNAERAHVDSTRGDHTVNGD 325 AS P P E C T F+N++ + + ++GD Sbjct: 41 ASGAPHPAALPIEGCNETGFINSQPSMAEFMTALPHLSGD 80 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,279 Number of Sequences: 336 Number of extensions: 1551 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -