BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30533 (855 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11E3.12 |||conserved eukaryotic protein|Schizosaccharomyces ... 53 6e-08 SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subu... 26 7.8 >SPAC11E3.12 |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 162 Score = 52.8 bits (121), Expect = 6e-08 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 1/80 (1%) Frame = +2 Query: 218 SRXFVGHLP*RSQRGAMIPLLDLAQRQSGGWLPISAMHKVAEILNLPKMRVYEVATFY-T 394 ++ + P R Q A++PLLDLAQRQ G W+P +AM+++A + + V+ + Y Sbjct: 15 AKAILARYPLRFQSAALVPLLDLAQRQHGTWIPPTAMYEIASLAGVSIDYVHSLILAYPN 74 Query: 395 MFIRRPIGKYHVQVCTTTPC 454 F RP K V++C + C Sbjct: 75 DFFWRP-KKPRVRICNSWMC 93 Score = 28.3 bits (60), Expect = 1.5 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +1 Query: 538 FSVSEVECLGACVNAPMIQVNDDYYEDLSVEDTKEIISKL 657 F V CLG C P + +ND Y + E +I+ L Sbjct: 118 FDVENTGCLGNCFQGPAMWINDKIYGVNTKEKLVDIMEAL 157 >SPAC3H5.06c |pol1|swi7, polA|DNA polymerase alpha catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 1405 Score = 25.8 bits (54), Expect = 7.8 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +2 Query: 449 PCWLRGSDAILNAIKQETNCRLE 517 PCWL+ +A+K + CR+E Sbjct: 477 PCWLKIQQPNFDAVKNASWCRVE 499 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,651,125 Number of Sequences: 5004 Number of extensions: 77684 Number of successful extensions: 200 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 195 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 200 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 424464280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -