BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30532 (652 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 24 1.1 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.8 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/44 (29%), Positives = 20/44 (45%) Frame = +1 Query: 484 AKPIRRQSRGCDQSHRSPTRQEGAPRIPQSGLRTPLEPISPSAA 615 +KP G D+ + + EG P S +R + PI+ S A Sbjct: 557 SKPPVATMYGSDEEIINSSNDEGGKTSPNSAVRKCMSPINGSGA 600 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.8 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +1 Query: 307 SAM*SAPPPEFHSATSNCQNTSMMITSRRIRSASNVQSNAKRVMTSLP 450 +A+ S PPP F + + + S ++++ R + + +A M +P Sbjct: 374 TALMSQPPPNFGVSQVSPVSMSALVSAVRSPAGGQLPPSAGAPMPPIP 421 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,633 Number of Sequences: 438 Number of extensions: 4201 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -