BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30531 (306 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY061110-1|AAL28658.1| 221|Drosophila melanogaster LD09559p pro... 59 1e-09 AE013599-451|AAM71098.1| 221|Drosophila melanogaster CG30499-PA... 59 1e-09 >AY061110-1|AAL28658.1| 221|Drosophila melanogaster LD09559p protein. Length = 221 Score = 58.8 bits (136), Expect = 1e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 152 LKALIGPSILNADLSQLYEESQKLLDNGADYLHL 253 ++A IGPSILNADLS L ESQKLLDNGADYLHL Sbjct: 3 VQAKIGPSILNADLSNLAAESQKLLDNGADYLHL 36 Score = 37.9 bits (84), Expect = 0.002 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 256 VMDGQFVPNLTFGHPVV 306 VMDG FVPNLTFGHP+V Sbjct: 38 VMDGTFVPNLTFGHPMV 54 >AE013599-451|AAM71098.1| 221|Drosophila melanogaster CG30499-PA protein. Length = 221 Score = 58.8 bits (136), Expect = 1e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 152 LKALIGPSILNADLSQLYEESQKLLDNGADYLHL 253 ++A IGPSILNADLS L ESQKLLDNGADYLHL Sbjct: 3 VQAKIGPSILNADLSNLAAESQKLLDNGADYLHL 36 Score = 37.9 bits (84), Expect = 0.002 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +1 Query: 256 VMDGQFVPNLTFGHPVV 306 VMDG FVPNLTFGHP+V Sbjct: 38 VMDGTFVPNLTFGHPMV 54 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,089,584 Number of Sequences: 53049 Number of extensions: 138075 Number of successful extensions: 214 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 214 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 568694034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -