BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30529 (709 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC150283-1|AAI50284.1| 2080|Homo sapiens peroxisomal proliferato... 30 7.1 AM050949-1|CAJ19486.1| 107|Homo sapiens immunoglobulin heavy ch... 30 7.1 AL121829-16|CAI95749.1| 2080|Homo sapiens RP4-697K14.7 protein. 30 7.1 AF517673-1|AAM74197.1| 2080|Homo sapiens peroxisomal proliferato... 30 7.1 AB201715-1|BAE46995.1| 2649|Homo sapiens PPAR gamma DBD-interact... 30 7.1 AB051556-1|BAB21860.2| 2114|Homo sapiens KIAA1769 protein protein. 30 7.1 >BC150283-1|AAI50284.1| 2080|Homo sapiens peroxisomal proliferator-activated receptor A interacting complex 285 protein. Length = 2080 Score = 30.3 bits (65), Expect = 7.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 266 SVFNNRSPVTTLLLLTSEVASQRLKYL--SESVASSHRHMQYEQCQNNQRHH 117 S+ R + L LT E AS +LK L + SV S R + YE+ + R H Sbjct: 848 SLLPGRDRLAISLFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH 899 >AM050949-1|CAJ19486.1| 107|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 107 Score = 30.3 bits (65), Expect = 7.1 Identities = 15/58 (25%), Positives = 29/58 (50%) Frame = +1 Query: 124 RWLFWHCSYCMCLCDDATDSDRYFSLWDATSDVNNNKVVTGLRLLNTEEYSIYKCTRA 297 +W+ W +Y D+ T + R+ T+D + + LR L +++ ++Y C RA Sbjct: 30 KWMGWISTYS----DNTTYAQRFQGRVIMTTDTSTSTAYMELRSLRSDDTAVYYCARA 83 >AL121829-16|CAI95749.1| 2080|Homo sapiens RP4-697K14.7 protein. Length = 2080 Score = 30.3 bits (65), Expect = 7.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 266 SVFNNRSPVTTLLLLTSEVASQRLKYL--SESVASSHRHMQYEQCQNNQRHH 117 S+ R + L LT E AS +LK L + SV S R + YE+ + R H Sbjct: 848 SLLPGRDRLAISLFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH 899 >AF517673-1|AAM74197.1| 2080|Homo sapiens peroxisomal proliferator-activated receptor A interacting complex-285 peptide protein. Length = 2080 Score = 30.3 bits (65), Expect = 7.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 266 SVFNNRSPVTTLLLLTSEVASQRLKYL--SESVASSHRHMQYEQCQNNQRHH 117 S+ R + L LT E AS +LK L + SV S R + YE+ + R H Sbjct: 848 SLLPGRDRLAISLFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH 899 >AB201715-1|BAE46995.1| 2649|Homo sapiens PPAR gamma DBD-interacting protein1 beta protein. Length = 2649 Score = 30.3 bits (65), Expect = 7.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 266 SVFNNRSPVTTLLLLTSEVASQRLKYL--SESVASSHRHMQYEQCQNNQRHH 117 S+ R + L LT E AS +LK L + SV S R + YE+ + R H Sbjct: 1417 SLLPGRDRLAISLFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH 1468 >AB051556-1|BAB21860.2| 2114|Homo sapiens KIAA1769 protein protein. Length = 2114 Score = 30.3 bits (65), Expect = 7.1 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 266 SVFNNRSPVTTLLLLTSEVASQRLKYL--SESVASSHRHMQYEQCQNNQRHH 117 S+ R + L LT E AS +LK L + SV S R + YE+ + R H Sbjct: 882 SLLPGRDRLAISLFLTMEKASGQLKSLRFAPSVVQSDRQLSYEEAEEVIRQH 933 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,326,280 Number of Sequences: 237096 Number of extensions: 2080089 Number of successful extensions: 11152 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10839 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11152 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8231208258 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -