BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30527 (432 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21.03c |||DUF55 family protein|Schizosaccharomyces pombe|chr... 25 6.6 SPBC2G5.03 |||ATP binding protein|Schizosaccharomyces pombe|chr ... 24 8.7 >SPBC21.03c |||DUF55 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 239 Score = 24.6 bits (51), Expect = 6.6 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = +3 Query: 84 ARKLPARNVNLPDATYITCSRCIF*TNRFYCELC 185 AR + + + D ++ CS C F + C++C Sbjct: 54 ARNMIRDEIKIGDYAFLYCSNCKFPHIKGLCQIC 87 >SPBC2G5.03 |||ATP binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 335 Score = 24.2 bits (50), Expect = 8.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 114 LPDATYITCSRCIF*TNRFYCELCLFL 194 LP T TC RC F ++ C+ C+ L Sbjct: 281 LPQQT--TCERCGFISSNRICKACMLL 305 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,326,888 Number of Sequences: 5004 Number of extensions: 21527 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 154067960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -