BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30527 (432 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 24 2.0 AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. 24 2.7 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 23 6.1 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 24.2 bits (50), Expect = 2.0 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = +2 Query: 113 LAGRDVHYVLKMYFLN*QILLRTLFVFNYISLI*SP 220 + G D +VL ++FLN L+ +FVF +++ +P Sbjct: 1 MVGSDSPHVLWIHFLNITQLISLIFVFLDDAIVANP 36 >AY344832-1|AAR05803.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 23.8 bits (49), Expect = 2.7 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -3 Query: 130 YVASGKFTLRAGSLRAHIAHTIPSH 56 YVA G L AGS RA IP+H Sbjct: 8 YVALG-LVLLAGSARAEPGEVIPNH 31 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 22.6 bits (46), Expect = 6.1 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 130 YVASGKFTLRAGSLRAHIAHTIPSH 56 Y+A G L AGS RA IP+H Sbjct: 8 YLALG-LVLLAGSARAEPGEVIPNH 31 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 340,143 Number of Sequences: 2352 Number of extensions: 5528 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -