BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30523 (811 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33442| Best HMM Match : AAA (HMM E-Value=0) 170 1e-42 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 111 5e-25 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 107 8e-24 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 5e-22 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 89 3e-18 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 81 8e-16 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 81 8e-16 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 9e-14 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 75 9e-14 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 2e-13 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 67 1e-11 SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 1e-09 SB_3115| Best HMM Match : AAA (HMM E-Value=0) 60 3e-09 SB_49367| Best HMM Match : AAA (HMM E-Value=0) 59 4e-09 SB_7424| Best HMM Match : AAA (HMM E-Value=0) 54 1e-07 SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 2e-07 SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) 54 2e-07 SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 7e-07 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 45 2e-06 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 3e-06 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_55690| Best HMM Match : AAA (HMM E-Value=0) 45 8e-05 SB_732| Best HMM Match : AAA (HMM E-Value=0) 39 0.004 SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) 39 0.004 SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) 38 0.007 SB_48094| Best HMM Match : MMR_HSR1 (HMM E-Value=0.82) 36 0.051 SB_8559| Best HMM Match : Dpy-30 (HMM E-Value=3.7e-11) 33 0.36 SB_29134| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.84 SB_50520| Best HMM Match : zf-DNL (HMM E-Value=3.4) 31 1.1 SB_31987| Best HMM Match : Troponin (HMM E-Value=7.1) 31 1.1 SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) 31 1.1 SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) 31 1.1 SB_50799| Best HMM Match : I-set (HMM E-Value=0) 31 1.5 SB_18883| Best HMM Match : DUF734 (HMM E-Value=8.4) 31 1.5 SB_11522| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.5 SB_33075| Best HMM Match : Big_2 (HMM E-Value=1.7) 30 1.9 SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) 30 2.6 SB_27648| Best HMM Match : Ribosomal_L18ae (HMM E-Value=2.8) 30 2.6 SB_12505| Best HMM Match : FHA (HMM E-Value=0.097) 30 2.6 SB_27422| Best HMM Match : Dynamin_N (HMM E-Value=3) 29 3.4 SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) 29 4.5 SB_55825| Best HMM Match : Arch_fla_DE (HMM E-Value=2.9) 29 4.5 SB_52778| Best HMM Match : BK_channel_a (HMM E-Value=2.3) 29 5.9 SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.9 SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) 29 5.9 SB_39137| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_26930| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) 28 7.8 SB_14925| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.8 SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) 28 7.8 SB_31| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) 28 7.8 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 170 bits (414), Expect = 1e-42 Identities = 89/120 (74%), Positives = 95/120 (79%) Frame = +1 Query: 238 KNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTG 417 K + LEVQEEYIKDEQ+NLKKE LHAQEEVKRIQSVPLVIGQFLEAVDQNTGIV STTG Sbjct: 48 KQLEFLEVQEEYIKDEQKNLKKELLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVASTTG 107 Query: 418 SNYYVRILSTIDRELLKPSASVALHKHSNAQLTSCLLKPTAQSLCCKLMRNLMFNIRILE 597 SNYYVRILSTID+ELLKPSASVALHKHSNA + +L P A S L N+ E Sbjct: 108 SNYYVRILSTIDKELLKPSASVALHKHSNALVD--ILPPEADSSIAMLTNEEKPNVSYAE 165 Score = 157 bits (382), Expect = 8e-39 Identities = 70/84 (83%), Positives = 79/84 (94%) Frame = +3 Query: 510 VDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPP 689 VD+LPPEADSSI+ML +EKP+V Y++IGGMD QKQEIREAVELPLTH ELY+QIGI+PP Sbjct: 139 VDILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVELPLTHFELYKQIGIDPP 198 Query: 690 RGVLMYGPPGCGKTMLAKAVAHHT 761 RGVL+YGPPGCGKTMLAKAVAHHT Sbjct: 199 RGVLLYGPPGCGKTMLAKAVAHHT 222 Score = 40.7 bits (91), Expect = 0.001 Identities = 24/71 (33%), Positives = 39/71 (54%), Gaps = 2/71 (2%) Frame = +2 Query: 104 MEEIGIILPEKDDQVTDSKGLA--FAGPQSFDELESEDLYTKYKKLQRMLEF*KYKKSTL 277 MEEIGII P++D + A + S + E +DLY YKKL++ LEF + ++ + Sbjct: 1 MEEIGIIQPQEDKSTSSRPTTAGTISSLCSPVDPEMDDLYITYKKLEKQLEFLEVQEEYI 60 Query: 278 KMNNET*RKNI 310 K + +K + Sbjct: 61 KDEQKNLKKEL 71 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 111 bits (268), Expect = 5e-25 Identities = 48/84 (57%), Positives = 68/84 (80%) Frame = +3 Query: 510 VDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPP 689 V VL +AD +++++ ++ P Y+DIGG+DTQ QEI+E+VELPLTH ELY ++GI+PP Sbjct: 355 VGVLSDDADPMVTVMKLEKAPQESYADIGGLDTQIQEIKESVELPLTHPELYEEMGIKPP 414 Query: 690 RGVLMYGPPGCGKTMLAKAVAHHT 761 +GV++YG PG GKT+LAKAVA+ T Sbjct: 415 KGVILYGQPGTGKTLLAKAVANQT 438 Score = 62.5 bits (145), Expect = 4e-10 Identities = 31/84 (36%), Positives = 54/84 (64%), Gaps = 3/84 (3%) Frame = +1 Query: 253 LEVQEEYIKDEQRNLKKEYLHAQE--EVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNY 426 L ++EE+I++++R +E H +E +V ++ P+ +G E +D N IV ++ GS + Sbjct: 267 LLMEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEH 326 Query: 427 YVRILSTIDRELLKPSASVAL-HK 495 YV ILS +D++LL+P +V L HK Sbjct: 327 YVSILSFVDKDLLEPGCTVLLNHK 350 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 107 bits (258), Expect = 8e-24 Identities = 46/81 (56%), Positives = 62/81 (76%) Frame = +3 Query: 519 LPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGV 698 LPP+ D +++M+Q +EKPDV YSDIGG Q ++RE VE PL H E + +GIEPP+GV Sbjct: 62 LPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERFVNLGIEPPKGV 121 Query: 699 LMYGPPGCGKTMLAKAVAHHT 761 L++GPPG GKT+ A+AVA+ T Sbjct: 122 LLFGPPGTGKTLCARAVANRT 142 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 101 bits (243), Expect = 5e-22 Identities = 41/79 (51%), Positives = 60/79 (75%) Frame = +3 Query: 528 EADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMY 707 E D +S++ ++ PD Y +GG+D Q +EI+E +ELP+ H EL+ +GI+ P+GVL+Y Sbjct: 158 EVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPKGVLLY 217 Query: 708 GPPGCGKTMLAKAVAHHTK 764 GPPG GKT+LA+AVAHHT+ Sbjct: 218 GPPGTGKTLLARAVAHHTE 236 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 89.4 bits (212), Expect = 3e-18 Identities = 38/79 (48%), Positives = 55/79 (69%) Frame = +3 Query: 540 SISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPG 719 S+ ++ K V + IGG+ TQ Q +RE +E+PLT+ EL+ G+ PPRG+L+YGP G Sbjct: 241 SVIKKDSEAKKGVSFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPRGILLYGPSG 300 Query: 720 CGKTMLAKAVAHHTKLHSF 776 GKTM+A+AVA+ T +H F Sbjct: 301 TGKTMIARAVANETGVHFF 319 Score = 89.0 bits (211), Expect = 4e-18 Identities = 37/79 (46%), Positives = 56/79 (70%) Frame = +3 Query: 564 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAK 743 E P V +SD+GG + K++++EAVE PL H E ++++GI PPRG+LMYGPPGC KT++A+ Sbjct: 530 EVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPRGILMYGPPGCSKTLIAR 589 Query: 744 AVAHHTKLHSFVSSDQSLY 800 A+A + L+ L+ Sbjct: 590 ALATESGLNFIAIKGPELF 608 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 81.4 bits (192), Expect = 8e-16 Identities = 31/68 (45%), Positives = 50/68 (73%) Frame = +3 Query: 519 LPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGV 698 LP E D + + ++ ++ YSD+GG+ Q +E+RE +ELPLT+ EL++++GI PP+G Sbjct: 113 LPREVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPELFQRVGIAPPKGC 172 Query: 699 LMYGPPGC 722 L++GPPGC Sbjct: 173 LLFGPPGC 180 Score = 47.6 bits (108), Expect = 1e-05 Identities = 23/81 (28%), Positives = 46/81 (56%) Frame = +1 Query: 247 RVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNY 426 R L+ + + ++++ ++ KEY ++ ++K +QSV ++G+ L+ + + IV +T G Y Sbjct: 22 RELDARLKEMREQLKDFTKEYDKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRY 81 Query: 427 YVRILSTIDRELLKPSASVAL 489 V +D+ LK VAL Sbjct: 82 VVGCRRQVDKAKLKQGTRVAL 102 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 81.4 bits (192), Expect = 8e-16 Identities = 34/73 (46%), Positives = 54/73 (73%) Frame = +3 Query: 564 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAK 743 E P+V + DIGG++ K+E++E V+ P+ H + + + G+ P +GVL YGPPGCGKT+LAK Sbjct: 303 EVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAK 362 Query: 744 AVAHHTKLHSFVS 782 A+A+ + +F+S Sbjct: 363 AIANECQA-NFIS 374 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 74.5 bits (175), Expect = 9e-14 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = +3 Query: 579 QYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVAHH 758 ++ D+GG++ KQ +R+A+E PL H E + ++G+ PRGVL+YGPPGC KT L +A A Sbjct: 482 RWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTLVRAAASS 541 Query: 759 T 761 T Sbjct: 542 T 542 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/74 (29%), Positives = 41/74 (55%) Frame = +3 Query: 516 VLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRG 695 V+ + + +I ++ D + G+D + ++E V+ PL + E + +GI P+G Sbjct: 188 VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKG 247 Query: 696 VLMYGPPGCGKTML 737 +L+ G PG GKT+L Sbjct: 248 ILLVGAPGVGKTLL 261 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 74.5 bits (175), Expect = 9e-14 Identities = 30/61 (49%), Positives = 44/61 (72%) Frame = +3 Query: 579 QYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVAHH 758 ++ D+GG++ KQ +R+A+E PL H E + ++G+ PRGVL+YGPPGC KT L +A A Sbjct: 11 RWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPRGVLLYGPPGCCKTTLVRAAASS 70 Query: 759 T 761 T Sbjct: 71 T 71 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 73.7 bits (173), Expect = 2e-13 Identities = 35/78 (44%), Positives = 52/78 (66%) Frame = +3 Query: 537 SSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPP 716 S + A + PD+ + D+GG+D+ K+EI + ++LPL H EL+ G+ GVL+YGPP Sbjct: 796 SHADAIGAPKIPDISWKDVGGLDSVKEEILDTIQLPLLHPELF-AAGLR-RSGVLLYGPP 853 Query: 717 GCGKTMLAKAVAHHTKLH 770 G GKT++AKAVA L+ Sbjct: 854 GTGKTLMAKAVATECSLN 871 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 67.3 bits (157), Expect = 1e-11 Identities = 28/73 (38%), Positives = 49/73 (67%) Frame = +3 Query: 537 SSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPP 716 + + + D K V++ +GG++ Q Q ++E + PL + E++ + I PPRGVL +GPP Sbjct: 870 ADVDPMSVDRK--VKFDSVGGLNKQIQALKEMILFPLVYPEVFDKFKITPPRGVLFFGPP 927 Query: 717 GCGKTMLAKAVAH 755 G GKT++A+A+A+ Sbjct: 928 GTGKTLVARALAN 940 >SB_56202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 60.9 bits (141), Expect = 1e-09 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = +3 Query: 564 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAK 743 + P+V ++DI + K+ + EAV LPL + ++ I P RGVLM GPPG GKTMLAK Sbjct: 243 KNPNVHWADIADLHEAKKLLEEAVVLPLLMPDYFQGIR-RPWRGVLMVGPPGTGKTMLAK 301 Query: 744 AVA 752 AVA Sbjct: 302 AVA 304 >SB_3115| Best HMM Match : AAA (HMM E-Value=0) Length = 913 Score = 59.7 bits (138), Expect = 3e-09 Identities = 28/63 (44%), Positives = 39/63 (61%) Frame = +3 Query: 564 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAK 743 +K ++ D+ GM K E+ E V+ L Y Q+G + P+G L+ GPPG GKT+LAK Sbjct: 118 DKGSARFKDVAGMQEAKMEVMEFVDY-LKSAGRYTQLGAKIPKGALLVGPPGTGKTLLAK 176 Query: 744 AVA 752 AVA Sbjct: 177 AVA 179 >SB_49367| Best HMM Match : AAA (HMM E-Value=0) Length = 976 Score = 59.3 bits (137), Expect = 4e-09 Identities = 24/65 (36%), Positives = 43/65 (66%) Frame = +3 Query: 558 ADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTML 737 A + V+++DIGG +++ + + + + H E++ +G+ P G L++GPPGCGKT+L Sbjct: 668 ASTQSSVKFADIGGCSNTLEQVGKLL-VHMCHPEVFTTLGVTPTTGFLLHGPPGCGKTLL 726 Query: 738 AKAVA 752 A A+A Sbjct: 727 AHAIA 731 >SB_7424| Best HMM Match : AAA (HMM E-Value=0) Length = 294 Score = 54.0 bits (124), Expect = 1e-07 Identities = 25/58 (43%), Positives = 38/58 (65%) Frame = +3 Query: 579 QYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVA 752 ++ D+ G + K EI E V L + + Y ++G + P+G ++ GPPG GKT+LAKAVA Sbjct: 46 EWIDVAGCEEAKLEIMEFVNF-LKNPQQYHELGAKIPKGAILSGPPGTGKTLLAKAVA 102 >SB_33907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/47 (46%), Positives = 35/47 (74%) Frame = +3 Query: 642 PLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVAHHTKLHSFVS 782 P+ H E + +G+ P G+L+ GPPGCGKT+LAKA+A+ + + +F+S Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGI-NFIS 47 >SB_17703| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 611 Score = 53.6 bits (123), Expect = 2e-07 Identities = 22/47 (46%), Positives = 35/47 (74%) Frame = +3 Query: 642 PLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVAHHTKLHSFVS 782 P+ H E + +G+ P G+L+ GPPGCGKT+LAKA+A+ + + +F+S Sbjct: 2 PVQHPEEFSALGLTHPPGILLAGPPGCGKTLLAKAIANESGI-NFIS 47 >SB_35704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 51.6 bits (118), Expect = 7e-07 Identities = 27/62 (43%), Positives = 40/62 (64%) Frame = +3 Query: 600 MDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVAHHTKLHSFV 779 +D K+E++E VE L + E ++++G + P GVL+ G PG GKT+LAKAVA + F Sbjct: 136 VDEAKEELQEVVEF-LRNPEKFKRLGGKLPTGVLLIGSPGTGKTLLAKAVAGEAGVPFFF 194 Query: 780 SS 785 S Sbjct: 195 CS 196 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 45.2 bits (102), Expect(2) = 2e-06 Identities = 22/50 (44%), Positives = 35/50 (70%), Gaps = 1/50 (2%) Frame = +3 Query: 564 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPP-RGVLMYG 710 EKP+V++SDI G+++ K+ ++EAV LP+ L+ G P RG+L+YG Sbjct: 90 EKPNVKWSDIAGLESAKEALKEAVILPIKFPHLF--TGKRTPWRGILLYG 137 Score = 24.6 bits (51), Expect(2) = 2e-06 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 717 GCGKTMLAKAVAHHTKLHSFVSSDQS 794 G GK+ LAKAVA +F+S S Sbjct: 175 GTGKSYLAKAVATEANNSTFISVSSS 200 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 49.6 bits (113), Expect = 3e-06 Identities = 22/74 (29%), Positives = 41/74 (55%) Frame = +3 Query: 516 VLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRG 695 V+ + + +I ++ D + G+D + ++E V+ PL + E + +GI P+G Sbjct: 18 VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLGINGPKG 77 Query: 696 VLMYGPPGCGKTML 737 +L+ G PG GKT+L Sbjct: 78 ILLVGAPGVGKTLL 91 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 46.0 bits (104), Expect = 4e-05 Identities = 19/38 (50%), Positives = 27/38 (71%) Frame = +3 Query: 510 VDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEI 623 ++ LP E DS + ++ DE+P QYSDIGG+D Q QE+ Sbjct: 129 LEKLPAEYDSRVKAMEVDERPTEQYSDIGGLDQQIQEM 166 >SB_55690| Best HMM Match : AAA (HMM E-Value=0) Length = 1031 Score = 44.8 bits (101), Expect = 8e-05 Identities = 23/67 (34%), Positives = 38/67 (56%) Frame = +3 Query: 582 YSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAVAHHT 761 + ++GG+ K ++E + P L+ + + G+L+YGPPG GKT+LA VA Sbjct: 666 WENVGGLGPVKGVLQETLLWPSKFAGLFAKCPLRLRGGLLLYGPPGTGKTLLAGVVAKEC 725 Query: 762 KLHSFVS 782 L +F+S Sbjct: 726 GL-NFIS 731 >SB_732| Best HMM Match : AAA (HMM E-Value=0) Length = 388 Score = 39.1 bits (87), Expect = 0.004 Identities = 14/43 (32%), Positives = 29/43 (67%) Frame = +3 Query: 621 IREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTMLAKAV 749 +R A L ++ ++G++ +G+L++GPPG GKT++A+ + Sbjct: 160 VRRAFATRLFPADVVDKMGLKHVKGILLFGPPGTGKTLMARQI 202 >SB_46732| Best HMM Match : AAA (HMM E-Value=0.044) Length = 430 Score = 39.1 bits (87), Expect = 0.004 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = +3 Query: 690 RGVLMYGPPGCGKTMLAKAVAHHT 761 R +L YGPPG GKTM AK++A H+ Sbjct: 330 RNLLFYGPPGTGKTMFAKSLARHS 353 >SB_31892| Best HMM Match : AAA (HMM E-Value=6.2e-25) Length = 420 Score = 38.3 bits (85), Expect = 0.007 Identities = 16/30 (53%), Positives = 20/30 (66%) Frame = +3 Query: 663 YRQIGIEPPRGVLMYGPPGCGKTMLAKAVA 752 Y GI RG L+YGPPGCGK+ +A+A Sbjct: 214 YMDRGIPYRRGYLLYGPPGCGKSSFIQALA 243 >SB_48094| Best HMM Match : MMR_HSR1 (HMM E-Value=0.82) Length = 896 Score = 35.5 bits (78), Expect = 0.051 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = +3 Query: 573 DVQYSDIGGMDTQKQEIREAVELPLTHVELYR-QIGIEPPRGVLMYGPPGCGKTMLAKAV 749 D + + + TQK++I E + L + + I P +++ GP CGKT L + + Sbjct: 101 DSERDALEALRTQKEKIEEELAASLVSAQYFPLDERIHTPCSLMVVGPSQCGKTTLIQQL 160 Query: 750 AHH 758 HH Sbjct: 161 IHH 163 >SB_8559| Best HMM Match : Dpy-30 (HMM E-Value=3.7e-11) Length = 806 Score = 32.7 bits (71), Expect = 0.36 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 675 GIEPPRGVLMYGPPGCGKTMLAKAVAHHTKLH 770 G+ P R ++ GPP GKT++ K + H KLH Sbjct: 355 GLLPVRACIL-GPPASGKTLVVKQLCTHYKLH 385 >SB_29134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 31.5 bits (68), Expect = 0.84 Identities = 13/40 (32%), Positives = 24/40 (60%) Frame = +3 Query: 612 KQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKT 731 K+E++ + + L++VELY+++ +G YG CG T Sbjct: 33 KKEVQNSSIIDLSYVELYQKVNFLNLKGANSYGQLACGHT 72 >SB_50520| Best HMM Match : zf-DNL (HMM E-Value=3.4) Length = 277 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 3/59 (5%) Frame = +1 Query: 337 IQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILST-IDRELLKPS--ASVALHKHSN 504 +Q V+G + ++ Q T + +TTG + +RI S +D E + + ++LHKHSN Sbjct: 61 LQITTAVLGVYSWSLLQFTLVTTATTGKDNKIRIASNKVDAEKVDKAIDRKISLHKHSN 119 >SB_31987| Best HMM Match : Troponin (HMM E-Value=7.1) Length = 235 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/59 (32%), Positives = 30/59 (50%) Frame = +1 Query: 226 QETPKNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIV 402 Q T ++ E + +DE+R+ KE + +V+R++S V FL QN GIV Sbjct: 24 QATDTEMKPQEDRHAEAQDEERDSVKEKNRQRSDVERLRSTYHVSESFLAMDKQNEGIV 82 >SB_43853| Best HMM Match : AAA_5 (HMM E-Value=0) Length = 2065 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/42 (38%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 630 AVELPLTHVELYRQI-GIEPPRGVLMYGPPGCGKTMLAKAVA 752 A+ P T R + ++ PR +L+ G PG GKT L A+A Sbjct: 1597 ALSAPTTSQNATRILRALQLPRPILLEGSPGVGKTSLVSAIA 1638 >SB_16952| Best HMM Match : AAA_5 (HMM E-Value=0.47) Length = 1345 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/56 (33%), Positives = 26/56 (46%) Frame = +3 Query: 570 PDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPRGVLMYGPPGCGKTML 737 PDV Y D D + E V+ T ++ + R +L+ GP GCGKT L Sbjct: 326 PDVSYFDAA--DLLGEVFVETVDTVRTR--MFMDLASTSGRNILLTGPRGCGKTSL 377 >SB_50799| Best HMM Match : I-set (HMM E-Value=0) Length = 1195 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = -2 Query: 171 NAKPFESVTWSSFSGKIIPISSIVSIAKRFRVL 73 N KP VTWS G IP +S+ FRV+ Sbjct: 266 NGKPPPRVTWSKVGGASIPFVQSLSVNDNFRVV 298 >SB_18883| Best HMM Match : DUF734 (HMM E-Value=8.4) Length = 204 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = -3 Query: 320 CACKYSFFKFRCSSLMYSSCTSRTLTFFGVSCTLCINLQIRVHQKI 183 C C YS+F RC + + TS C+N+ +RV +++ Sbjct: 2 CKCVYSYFNKRCQRALCRTRTSFNAIRMAEQSDNCLNMYLRVLKQV 47 >SB_11522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +3 Query: 570 PDVQYSDIGGMDTQKQEIREAVELPL 647 PDV++ DI G+D K+ ++EAV P+ Sbjct: 52 PDVRWDDIIGLDAAKRLVKEAVVYPI 77 >SB_10418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = +3 Query: 699 LMYGPPGCGKTMLAKAVAHH 758 L+ GPPG GKT LA +A H Sbjct: 384 LLCGPPGLGKTTLAHVIAQH 403 >SB_33075| Best HMM Match : Big_2 (HMM E-Value=1.7) Length = 334 Score = 30.3 bits (65), Expect = 1.9 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 7/121 (5%) Frame = +1 Query: 208 RFIHKVQETPKNVR-VLEVQEEYIKDEQRNLKKEYLHAQEEVKRI------QSVPLVIGQ 366 RFI ++ + N V E I++E N + L + VK +SV + + Sbjct: 132 RFIRSMKSSDNNNNAVTRNSSEKIEEESENFQNTSLKSDAFVKAELALSGEKSVDISVDI 191 Query: 367 FLEAVDQNTGIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNAQLTSCLLKPTAQS 546 L+++D + G + S+ +++ + P+ VAL + ++ Q+ +PTA S Sbjct: 192 TLDSIDVDDGDIEVGDNSS------KQMEKRSVSPTPRVALSRANSTQIADSYRRPTAHS 245 Query: 547 L 549 L Sbjct: 246 L 246 >SB_35866| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.34) Length = 758 Score = 29.9 bits (64), Expect = 2.6 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 6/106 (5%) Frame = +1 Query: 220 KVQETPKNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNT-- 393 K +E + +R LE + + E+RN++K+YL Q E + + S L + + NT Sbjct: 621 KRKEIWREIRELETILKDVHKEKRNIEKKYLAFQHENREL-SRSLNSSRSPTGLSPNTSP 679 Query: 394 ----GIVGSTTGSNYYVRILSTIDRELLKPSASVALHKHSNAQLTS 519 G++ + G +L ++ L+K S + K N+ ++S Sbjct: 680 NRGIGMLVVSPGKTRTASLLERVNNLLMKTSMPNGVKKELNSPVSS 725 >SB_27648| Best HMM Match : Ribosomal_L18ae (HMM E-Value=2.8) Length = 796 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +3 Query: 651 HVELYRQIGIEP---PRGVLMYGPPGCGKT 731 H E RQ GI+P P L+ GP CGKT Sbjct: 74 HREALRQRGIDPKNIPFNALIVGPTSCGKT 103 >SB_12505| Best HMM Match : FHA (HMM E-Value=0.097) Length = 629 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/84 (25%), Positives = 44/84 (52%), Gaps = 1/84 (1%) Frame = +1 Query: 214 IHKVQETPKNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRI-QSVPLVIGQFLEAVDQN 390 +H++ + P V ++E+Y D+Q L+K+ L +E+++ + + V + +D+ Sbjct: 271 MHEIAQGPLQESVRALEEQYQADKQGALEKQRLMYEEKIEELKKEVQMSPFGSRPQIDRT 330 Query: 391 TGIVGSTTGSNYYVRILSTIDREL 462 + + S+ S Y R+ DREL Sbjct: 331 SSL--SSFSSGYGSRMSWYEDREL 352 >SB_27422| Best HMM Match : Dynamin_N (HMM E-Value=3) Length = 485 Score = 29.5 bits (63), Expect = 3.4 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 678 IEPPRGVLMYGPPGCGKTMLAKAVAHH 758 I P +++ GP CGKT L + + HH Sbjct: 6 IHTPCSLMVVGPSQCGKTTLIQQLIHH 32 >SB_55513| Best HMM Match : Pox_A32 (HMM E-Value=0.056) Length = 937 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 651 HVELYRQIGIEPPRGVLMYGPPGCGKT 731 H+E+ R G P L+ GP CGKT Sbjct: 468 HLEIKRTAGGSVPFNALIVGPTSCGKT 494 >SB_55825| Best HMM Match : Arch_fla_DE (HMM E-Value=2.9) Length = 208 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/53 (26%), Positives = 30/53 (56%) Frame = +1 Query: 247 RVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVG 405 +V + +++ K Q + KE+ + V+ + V+GQ +++VD+ G+VG Sbjct: 8 KVQDAEQKVTKGFQE-VGKEFQVVGQHVQSVDEKVGVVGQHVQSVDEKVGVVG 59 >SB_52778| Best HMM Match : BK_channel_a (HMM E-Value=2.3) Length = 179 Score = 28.7 bits (61), Expect = 5.9 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 730 LCWLKLLRITLSCIHSCRXIRVC 798 LCWL L L+C+ S R + VC Sbjct: 42 LCWLPFLSTYLTCLFSDRRLSVC 64 >SB_40168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1554 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 690 RGVLMYGPPGCGKTMLAKAVAHHTK 764 R V++YG GCGKT L +A K Sbjct: 445 RVVVLYGESGCGKTSLMAKIATQVK 469 >SB_379| Best HMM Match : ADK (HMM E-Value=3.2e-05) Length = 991 Score = 28.7 bits (61), Expect = 5.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +3 Query: 684 PPRGVLMYGPPGCGKTMLAKAVA 752 PP V + GPP GKT++AK +A Sbjct: 318 PPCKVCVLGPPHSGKTLVAKQLA 340 >SB_39137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 333 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/49 (26%), Positives = 29/49 (59%) Frame = +2 Query: 140 DQVTDSKGLAFAGPQSFDELESEDLYTKYKKLQRMLEF*KYKKSTLKMN 286 ++ T+ + LAF ++ DE ++++ T+ +KLQR+ + K+ + N Sbjct: 174 NETTEERKLAFENLKAKDEKSAKEIETQMRKLQRIQDNISQLKAKMASN 222 >SB_26930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1533 Score = 28.3 bits (60), Expect = 7.8 Identities = 20/69 (28%), Positives = 29/69 (42%) Frame = +1 Query: 256 EVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVR 435 E+ E I D K+YL EE+ ++ LVIG + V +N T + Sbjct: 684 EMLPEDITDGVSIQYKQYLKKDEELSSVEEPQLVIGGEEDRVSKNDNDANLATDAGVVHT 743 Query: 436 ILSTIDREL 462 +DREL Sbjct: 744 PNDGVDREL 752 >SB_26897| Best HMM Match : AAA (HMM E-Value=4.2e-12) Length = 230 Score = 28.3 bits (60), Expect = 7.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +3 Query: 696 VLMYGPPGCGKTMLAKAVA 752 +L YGPPG GKT AVA Sbjct: 13 LLFYGPPGTGKTSTILAVA 31 >SB_14925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 28.3 bits (60), Expect = 7.8 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -1 Query: 730 VLPQPGGPYMSTPRGGSIPICRYNST*VRGSSTASLISCFCVS 602 ++P+PG Y T G S C N+T V G T +C C S Sbjct: 48 MVPRPGFSYQGTKNGCSSSPCPVNTTCVPG-PTQDTHTCACPS 89 >SB_5831| Best HMM Match : TolA (HMM E-Value=0.0037) Length = 703 Score = 28.3 bits (60), Expect = 7.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +1 Query: 238 KNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVP 351 + VR+ E +EE K E+R KE VKR+ +P Sbjct: 601 EKVRLKEEEEERKKQEERKKAKEAGRRPSPVKRVSRIP 638 >SB_31| Best HMM Match : Myosin_tail_1 (HMM E-Value=0.083) Length = 902 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 223 VQETPKNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQ 342 V+ NVR LEV ++ D R+L+ H + V+ +Q Sbjct: 546 VRHLDDNVRHLEVSVRHLDDNVRHLQVSVRHLDDNVRHLQ 585 Score = 28.3 bits (60), Expect = 7.8 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +1 Query: 223 VQETPKNVRVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQ 342 V+ NVR LEV ++ D R+L+ H + V+ +Q Sbjct: 714 VRHLDDNVRHLEVSVRHLDDNVRHLQVSVRHLDDNVRHLQ 753 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,753,007 Number of Sequences: 59808 Number of extensions: 483124 Number of successful extensions: 2038 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 1804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2034 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2251677692 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -