Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30523
         (811 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    24   1.4  
DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.               22   5.8  

>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 10/42 (23%), Positives = 24/42 (57%)
 Frame = +1

Query: 247 RVLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFL 372
           +V E +   +K  +RN+K +    + E K  +++ +++G F+
Sbjct: 426 QVTEEKPRVMKMGKRNIKAQVKRFRMETKAAKTLGIIVGGFI 467


>DQ342041-1|ABC69933.1|  828|Apis mellifera STIP protein.
          Length = 828

 Score = 22.2 bits (45), Expect = 5.8
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = +3

Query: 396 HSWQHHWLKLL 428
           H+W H WL LL
Sbjct: 540 HTWIHPWLPLL 550


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 219,410
Number of Sequences: 438
Number of extensions: 5293
Number of successful extensions: 19
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 19
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 25731924
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)