BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30519 (765 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25700| Best HMM Match : Histone (HMM E-Value=1.8e-21) 94 1e-19 SB_10607| Best HMM Match : Histone (HMM E-Value=1.8e-21) 94 1e-19 SB_38872| Best HMM Match : Histone (HMM E-Value=3e-31) 87 1e-17 SB_41053| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_18888| Best HMM Match : Histone (HMM E-Value=1.4e-30) 87 2e-17 SB_1957| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_31726| Best HMM Match : Histone (HMM E-Value=9.6e-32) 86 3e-17 SB_26808| Best HMM Match : Histone (HMM E-Value=9.6e-32) 86 3e-17 SB_28450| Best HMM Match : Histone (HMM E-Value=2.8e-17) 85 4e-17 SB_39197| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_34142| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_32335| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_29672| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_25346| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_24338| Best HMM Match : Histone (HMM E-Value=9.7e-28) 85 6e-17 SB_23111| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_16864| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_13575| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_11336| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_10189| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_7802| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_4428| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 6e-17 SB_3228| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 6e-17 SB_59150| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_51806| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_49903| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_46692| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_40749| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_39962| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_25215| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_20041| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_18317| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_14748| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_2687| Best HMM Match : Histone (HMM E-Value=4e-29) 85 6e-17 SB_52376| Best HMM Match : Histone (HMM E-Value=3e-30) 85 8e-17 SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) 85 8e-17 SB_58161| Best HMM Match : Histone (HMM E-Value=3.3e-28) 84 1e-16 SB_17375| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_57970| Best HMM Match : Histone (HMM E-Value=9.8e-31) 83 2e-16 SB_24672| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_45974| Best HMM Match : Histone (HMM E-Value=1.6e-28) 83 2e-16 SB_5066| Best HMM Match : Histone (HMM E-Value=9.8e-31) 83 2e-16 SB_56481| Best HMM Match : Histone (HMM E-Value=8.6e-29) 83 3e-16 SB_18627| Best HMM Match : Histone (HMM E-Value=1.7e-30) 83 3e-16 SB_59033| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_54997| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_21882| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_53326| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_51153| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_23163| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 8e-14 SB_9565| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_6661| Best HMM Match : Histone (HMM E-Value=0.024) 75 8e-14 SB_30494| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 8e-13 SB_57723| Best HMM Match : Histone (HMM E-Value=0.072) 70 2e-12 SB_54711| Best HMM Match : Histone (HMM E-Value=0.086) 68 7e-12 SB_51995| Best HMM Match : Histone (HMM E-Value=3.7e-15) 64 9e-11 SB_21879| Best HMM Match : Histone (HMM E-Value=1.4e-08) 62 5e-10 SB_12210| Best HMM Match : Histone (HMM E-Value=1.4e-08) 62 5e-10 SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) 48 8e-06 SB_35615| Best HMM Match : Histone (HMM E-Value=6.9e-06) 47 1e-05 SB_38498| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_18236| Best HMM Match : Histone (HMM E-Value=1.2) 47 2e-05 SB_21819| Best HMM Match : Ribosomal_L23eN (HMM E-Value=5) 45 6e-05 SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098) 32 0.58 SB_43786| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13378| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_48989| Best HMM Match : Ank (HMM E-Value=7.6e-05) 29 3.1 SB_17799| Best HMM Match : CBM_21 (HMM E-Value=4.8e-34) 29 4.1 SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10) 28 9.5 >SB_25700| Best HMM Match : Histone (HMM E-Value=1.8e-21) Length = 123 Score = 94.3 bits (224), Expect = 1e-19 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = +3 Query: 216 LQSAEAGPSRHRYSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLF 395 L+ AEA P RHR KAM IMNSFVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL Sbjct: 43 LKQAEASPPRHR---KAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLL 99 Query: 396 V 398 + Sbjct: 100 L 100 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 196 ESYAIYIYKVLKQ 234 ESYAIYIYKVLKQ Sbjct: 33 ESYAIYIYKVLKQ 45 >SB_10607| Best HMM Match : Histone (HMM E-Value=1.8e-21) Length = 123 Score = 94.3 bits (224), Expect = 1e-19 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = +3 Query: 216 LQSAEAGPSRHRYSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLF 395 L+ AEA P RHR KAM IMNSFVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL Sbjct: 43 LKQAEASPPRHR---KAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLL 99 Query: 396 V 398 + Sbjct: 100 L 100 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 196 ESYAIYIYKVLKQ 234 ESYAIYIYKVLKQ Sbjct: 33 ESYAIYIYKVLKQ 45 >SB_38872| Best HMM Match : Histone (HMM E-Value=3e-31) Length = 242 Score = 87.4 bits (207), Expect = 1e-17 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFVRDG 407 SSKAM IMNSFVNDIFERIA EASRLAHYNKRSTI+SREVQT+VRL + G Sbjct: 52 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTISSREVQTAVRLLLPAG 102 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_41053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 86.6 bits (205), Expect = 2e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 57 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 104 Score = 28.7 bits (61), Expect = 5.4 Identities = 14/21 (66%), Positives = 14/21 (66%) Frame = +1 Query: 202 YAIYIYKVLKQVHPDTGIRVK 264 Y IY VLKQVH DTGI K Sbjct: 39 YVERIYWVLKQVHHDTGISSK 59 >SB_18888| Best HMM Match : Histone (HMM E-Value=1.4e-30) Length = 123 Score = 86.6 bits (205), Expect = 2e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 53 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 100 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 33 ESYAIYIYKVLKQVHPDTGISSK 55 >SB_1957| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 86.6 bits (205), Expect = 2e-17 Identities = 42/48 (87%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNKRSTI+SREVQT+VRL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTISSREVQTAVRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_31726| Best HMM Match : Histone (HMM E-Value=9.6e-32) Length = 123 Score = 85.8 bits (203), Expect = 3e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 53 SSKAMVIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 100 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESY+IYIYKVLKQVHPDTGI K Sbjct: 33 ESYSIYIYKVLKQVHPDTGISSK 55 >SB_26808| Best HMM Match : Histone (HMM E-Value=9.6e-32) Length = 123 Score = 85.8 bits (203), Expect = 3e-17 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 53 SSKAMVIMNSFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 100 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESY+IYIYKVLKQVHPDTGI K Sbjct: 33 ESYSIYIYKVLKQVHPDTGISSK 55 >SB_28450| Best HMM Match : Histone (HMM E-Value=2.8e-17) Length = 100 Score = 85.4 bits (202), Expect = 4e-17 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +3 Query: 243 RHRYSSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 R SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 26 RKGISSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 77 >SB_39197| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_34142| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_32335| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_29672| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_25346| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_24338| Best HMM Match : Histone (HMM E-Value=9.7e-28) Length = 100 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_23111| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_16864| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 125 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_13575| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_11336| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 115 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 45 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 92 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 25 ESYAIYIYKVLKQVHPDTGISSK 47 >SB_10189| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_7802| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_4428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 74 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 121 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 54 ESYAIYIYKVLKQVHPDTGISSK 76 >SB_3228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_59150| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_51806| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_49903| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_46692| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 103 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 33 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 80 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 13 ESYAIYIYKVLKQVHPDTGISSK 35 >SB_40749| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_39962| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 98 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 28 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 75 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 8 ESYAIYIYKVLKQVHPDTGISSK 30 >SB_25215| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_20041| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_18317| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_14748| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_2687| Best HMM Match : Histone (HMM E-Value=4e-29) Length = 122 Score = 85.0 bits (201), Expect = 6e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_52376| Best HMM Match : Histone (HMM E-Value=3e-30) Length = 122 Score = 84.6 bits (200), Expect = 8e-17 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMN FVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 52 SSKAMGIMNCFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_55463| Best HMM Match : OPA3 (HMM E-Value=0) Length = 387 Score = 84.6 bits (200), Expect = 8e-17 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMN FVNDIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 52 SSKAMGIMNCFVNDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_58161| Best HMM Match : Histone (HMM E-Value=3.3e-28) Length = 122 Score = 83.8 bits (198), Expect = 1e-16 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNS+VNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 52 SSKAMGIMNSYVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_17375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 247 Score = 83.8 bits (198), Expect = 1e-16 Identities = 40/48 (83%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFV+DIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 177 SSKAMVIMNSFVHDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 224 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 157 ESYAIYIYKVLKQVHPDTGISSK 179 >SB_57970| Best HMM Match : Histone (HMM E-Value=9.8e-31) Length = 118 Score = 83.4 bits (197), Expect = 2e-16 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+ TI+SREVQT+VRL + Sbjct: 48 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKKHTISSREVQTAVRLLL 95 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVL+QVHPDTGI K Sbjct: 28 ESYAIYIYKVLRQVHPDTGISSK 50 >SB_24672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 83.4 bits (197), Expect = 2e-16 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+ TI+SREVQT+VRL + Sbjct: 48 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKKHTISSREVQTAVRLLL 95 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVL+QVHPDTGI K Sbjct: 28 ESYAIYIYKVLRQVHPDTGISSK 50 >SB_45974| Best HMM Match : Histone (HMM E-Value=1.6e-28) Length = 122 Score = 83.4 bits (197), Expect = 2e-16 Identities = 38/48 (79%), Positives = 46/48 (95%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+STI+S+E+QT++RL + Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKSTISSQEIQTAIRLLL 99 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_5066| Best HMM Match : Histone (HMM E-Value=9.8e-31) Length = 118 Score = 83.4 bits (197), Expect = 2e-16 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMNSFVNDIFERIA EASRLAHYNK+ TI+SREVQT+VRL + Sbjct: 48 SSKAMGIMNSFVNDIFERIAGEASRLAHYNKKHTISSREVQTAVRLLL 95 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/23 (86%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVL+QVHPDTGI K Sbjct: 28 ESYAIYIYKVLRQVHPDTGISSK 50 >SB_56481| Best HMM Match : Histone (HMM E-Value=8.6e-29) Length = 125 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 S+KAM IMNSFVNDIFERIA EASRLA+YNK+STITSRE+QT+VRL + Sbjct: 55 STKAMGIMNSFVNDIFERIAGEASRLANYNKKSTITSREIQTAVRLLL 102 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESY YIYKVLKQVHPDTGI K Sbjct: 35 ESYLTYIYKVLKQVHPDTGISTK 57 >SB_18627| Best HMM Match : Histone (HMM E-Value=1.7e-30) Length = 279 Score = 82.6 bits (195), Expect = 3e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 SSKAM IMN FVNDIFERIA EAS LAHYNK+STITSRE+QT+VRL + Sbjct: 53 SSKAMGIMNCFVNDIFERIAGEASHLAHYNKKSTITSREIQTAVRLLL 100 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 33 ESYAIYIYKVLKQVHPDTGISSK 55 >SB_59033| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_54997| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_21882| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_53326| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_51153| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_23163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_9565| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_6661| Best HMM Match : Histone (HMM E-Value=0.024) Length = 64 Score = 74.5 bits (175), Expect = 8e-14 Identities = 33/41 (80%), Positives = 40/41 (97%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 MNSFVNDIFERIAAE+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MNSFVNDIFERIAAESSRLAHYNKKSTISSREIQTAIRLLL 41 >SB_30494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 71.3 bits (167), Expect = 8e-13 Identities = 35/48 (72%), Positives = 40/48 (83%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 + KAM IMNSFVND+FERIA EA+RLA N R TITSREVQT+VRL + Sbjct: 87 NKKAMGIMNSFVNDMFERIAGEAARLAMMNHRRTITSREVQTAVRLIL 134 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/23 (73%), Positives = 18/23 (78%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESY Y+YKVLKQVHPD GI K Sbjct: 67 ESYGSYLYKVLKQVHPDIGINKK 89 >SB_57723| Best HMM Match : Histone (HMM E-Value=0.072) Length = 64 Score = 70.1 bits (164), Expect = 2e-12 Identities = 31/41 (75%), Positives = 39/41 (95%) Frame = +3 Query: 276 MNSFVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 M+SFVNDIFERIAAE+ RLAHYNK+STI+SRE+QT++RL + Sbjct: 1 MDSFVNDIFERIAAESFRLAHYNKKSTISSREIQTAIRLLL 41 >SB_54711| Best HMM Match : Histone (HMM E-Value=0.086) Length = 61 Score = 68.1 bits (159), Expect = 7e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = +3 Query: 285 FVNDIFERIAAEASRLAHYNKRSTITSREVQTSVRLFV 398 FV+DIFERIA EASRLAHYNK+STITSRE+QT+VRL + Sbjct: 1 FVHDIFERIAGEASRLAHYNKKSTITSREIQTAVRLLL 38 >SB_51995| Best HMM Match : Histone (HMM E-Value=3.7e-15) Length = 138 Score = 64.5 bits (150), Expect = 9e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNKRS 353 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK+S Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNKKS 84 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_21879| Best HMM Match : Histone (HMM E-Value=1.4e-08) Length = 83 Score = 62.1 bits (144), Expect = 5e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNK 347 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNK 82 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_12210| Best HMM Match : Histone (HMM E-Value=1.4e-08) Length = 83 Score = 62.1 bits (144), Expect = 5e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEASRLAHYNK 347 SSKAM IMNSFVNDIFERIAAE+SRLAHYNK Sbjct: 52 SSKAMGIMNSFVNDIFERIAAESSRLAHYNK 82 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_54557| Best HMM Match : PHK_AB (HMM E-Value=0) Length = 863 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = -2 Query: 395 KQSH*SLNLPRGYRRTLVVMGETRSFCSDTFEDVVHERIHDRHGFTR 255 KQ++ L+ P LVV+ + SF SD EDVVHER+HD HG R Sbjct: 660 KQTNGRLDFPARDGGLLVVVRQAGSFTSDALEDVVHERVHDDHGLAR 706 >SB_35615| Best HMM Match : Histone (HMM E-Value=6.9e-06) Length = 122 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 33 ESYAIYIYKVLKQVHPDTGISSK 55 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = +3 Query: 255 SSKAMSIMNSFVNDIFERIAAEAS 326 SSKAM IMNSFVNDIFERIA EAS Sbjct: 53 SSKAMGIMNSFVNDIFERIAGEAS 76 >SB_38498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTGI K Sbjct: 32 ESYAIYIYKVLKQVHPDTGISSK 54 >SB_18236| Best HMM Match : Histone (HMM E-Value=1.2) Length = 74 Score = 46.8 bits (106), Expect = 2e-05 Identities = 19/27 (70%), Positives = 26/27 (96%) Frame = +3 Query: 318 EASRLAHYNKRSTITSREVQTSVRLFV 398 E+SRLAHYNK+STI+SRE+QT++RL + Sbjct: 25 ESSRLAHYNKKSTISSREIQTAIRLLL 51 >SB_21819| Best HMM Match : Ribosomal_L23eN (HMM E-Value=5) Length = 80 Score = 45.2 bits (102), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +1 Query: 196 ESYAIYIYKVLKQVHPDTGIRVK 264 ESYAIYIYKVLKQVHPDTG K Sbjct: 54 ESYAIYIYKVLKQVHPDTGSPAK 76 >SB_26181| Best HMM Match : DUF963 (HMM E-Value=0.00098) Length = 620 Score = 31.9 bits (69), Expect = 0.58 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -2 Query: 653 IYKLLISIYIVLYLC*LIFNITIYFPCPLLS 561 I +LL+ + ++L+LC +F+I+ YFP PL S Sbjct: 147 ILRLLLRLRLLLHLC--LFSISAYFPSPLTS 175 >SB_43786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 196 ESYAIYIYKVLKQ 234 ESYAIYIYKVLKQ Sbjct: 32 ESYAIYIYKVLKQ 44 >SB_13378| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.5 bits (63), Expect = 3.1 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +1 Query: 436 TVRDEHKNHSCSRRTFRKIRNSFRKVNR 519 +VR++ N SCS FR+ R F +++R Sbjct: 48 SVREQFANISCSANVFREFRERFSRISR 75 >SB_48989| Best HMM Match : Ank (HMM E-Value=7.6e-05) Length = 585 Score = 29.5 bits (63), Expect = 3.1 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -3 Query: 673 IFIFKQIFTNYLFLFTSFSIYVNLFLT*LFISPVLYYLFTDTFIYSLRT 527 IFI IF YL F++F IY+ + +T + + + YY +DT S T Sbjct: 281 IFIAWVIFVLYLRRFSTFGIYI-IMMTNIIKTLIKYYEDSDTTTSSTNT 328 >SB_17799| Best HMM Match : CBM_21 (HMM E-Value=4.8e-34) Length = 218 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -2 Query: 722 SDSLLRPHAKLKTTRTNLYFQTNIYKLLISIY 627 S S+LR H L R N++F K L+S+Y Sbjct: 24 SHSILRKHQSLPPKRKNVHFADGFGKPLVSVY 55 >SB_41992| Best HMM Match : efhand (HMM E-Value=2.4e-10) Length = 1303 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +2 Query: 320 SFSSRPLQQAFDDNLEGGSDFSEIVC 397 S + + L QAFD+N +G DF E+ C Sbjct: 40 SSACKGLFQAFDENNDGHIDFREMAC 65 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,484,272 Number of Sequences: 59808 Number of extensions: 369230 Number of successful extensions: 1176 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 1014 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1169 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2072022557 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -