Bombyx BLAST Result against spombe

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= heS30516
         (691 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC887.17 |||uracil permease |Schizosaccharomyces pombe|chr 2||...    27   3.4  

>SPBC887.17 |||uracil permease |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 625

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 11  SVPLYKNCYTFPLLSALFYCYTYLVNWSY-GTTIVTYRGAHL*NHSETVLFTFT--VICK 181
           S+P++    T  L+ ++    T L+NWSY G +I  +    L   + ++ +     +IC 
Sbjct: 428 SIPVWATGSTLVLVGSMMMKSTTLINWSYLGDSIPAFITIALMPFTYSIAYGLIAGIICY 487

Query: 182 YLIIFLYYSL 211
            L+  + Y++
Sbjct: 488 ALLNSIIYAI 497


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,821,271
Number of Sequences: 5004
Number of extensions: 57541
Number of successful extensions: 103
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 102
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 103
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 319939482
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)