BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30516 (691 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.38 SB_38875| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.2 >SB_19633| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 32.3 bits (70), Expect = 0.38 Identities = 17/65 (26%), Positives = 31/65 (47%) Frame = +2 Query: 20 LYKNCYTFPLLSALFYCYTYLVNWSYGTTIVTYRGAHL*NHSETVLFTFTVICKYLIIFL 199 +Y YT+ Y YTY ++Y T TY ++ + ++ + + Y+ I+L Sbjct: 23 IYIYIYTYTYTYTYTYTYTYTYTYTY-TYTYTYVYVYVYVYVYVYVYVYVYVYVYIYIYL 81 Query: 200 YYSLA 214 Y S+A Sbjct: 82 YDSIA 86 >SB_38875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1116 Score = 28.3 bits (60), Expect = 6.2 Identities = 16/42 (38%), Positives = 23/42 (54%) Frame = +1 Query: 391 LSLIVFAGHAMKNILDIFFILGYIIRVLVRIPNFFQKYYTYV 516 +S++V HA+K +L I ++ Y I LVR F Y YV Sbjct: 909 ISVLVQLSHALKVMLMIGVLIAYWIINLVRQDKLFVNYDKYV 950 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,837,104 Number of Sequences: 59808 Number of extensions: 380696 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 544 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 578 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1793485733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -