BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30513 (484 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14685| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.040 SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) 30 1.1 >SB_14685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 332 Score = 34.7 bits (76), Expect = 0.040 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +1 Query: 169 DKLPEWIKSRIEKEQWTKGRLNCEKCSCR 255 D LP WI I K QWT+G++ C KC R Sbjct: 60 DTLP-WIHVIIVKAQWTEGKIYCPKCKSR 87 Score = 33.1 bits (72), Expect = 0.12 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = +3 Query: 240 KMQLQIGSFDYISGRKCECGETVLPPVHFTSSQVDRPILSE 362 K + +IG+F++I G +C C V+P V +VD+ L + Sbjct: 83 KCKSRIGAFNFIHGVRCSCFTYVIPAVWIQKCKVDQTSLQD 123 >SB_31747| Best HMM Match : Myotub-related (HMM E-Value=0) Length = 550 Score = 29.9 bits (64), Expect = 1.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 21 ISCKSNAIKCLKCRTKLIDDISLITXXXFQCDPQ 122 I CK + K KC KL++D+ +I F +PQ Sbjct: 17 IKCKWSDPKGAKCEPKLVEDLHIIYKAKFGTEPQ 50 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,348,941 Number of Sequences: 59808 Number of extensions: 222211 Number of successful extensions: 512 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 512 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -