BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30513 (484 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-2897|AAF48988.1| 387|Drosophila melanogaster CG14211-P... 36 0.038 >AE014298-2897|AAF48988.1| 387|Drosophila melanogaster CG14211-PB protein. Length = 387 Score = 35.5 bits (78), Expect = 0.038 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +3 Query: 240 KMQLQIGSFDYISGRKCECGETVLPPVHFTSSQVD 344 K + ++G+F +I+ KC CGET+ P + S+V+ Sbjct: 341 KCEQKLGNFSWINACKCPCGETMTPAFYLIPSKVE 375 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,869,139 Number of Sequences: 53049 Number of extensions: 329418 Number of successful extensions: 630 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1684597257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -