BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30513 (484 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 23 2.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 5.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 9.1 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.6 bits (46), Expect = 2.3 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -1 Query: 385 DLFNFNAFSDNIGLSTWLLVKCTGGKT 305 +LF+ F+ NI ST LL K GG + Sbjct: 106 ELFDATVFTYNITNSTPLLKKLYGGNS 132 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 5.2 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +1 Query: 181 EWIKSRIEKEQWTKGRLNCEKCSCRSDHSTIFLGENVN 294 +W E + T G + E C S++STI G N N Sbjct: 198 DWQPEDEECTEATAGAVVLETCQRNSNNSTITAG-NAN 234 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 20.6 bits (41), Expect = 9.1 Identities = 9/30 (30%), Positives = 13/30 (43%) Frame = +1 Query: 220 KGRLNCEKCSCRSDHSTIFLGENVNVVKQF 309 K L C+KCS + EN +Q+ Sbjct: 145 KSNLKCDKCSTYQSNGEEVCLENCTGYQQY 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 111,957 Number of Sequences: 438 Number of extensions: 2109 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13174803 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -