BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30511 (693 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0507 + 3655570-3655573,3655648-3655832 44 1e-04 10_06_0161 + 11344712-11344877,11345870-11346084 29 4.6 >06_01_0507 + 3655570-3655573,3655648-3655832 Length = 62 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/20 (95%), Positives = 20/20 (100%) Frame = -2 Query: 104 GKVHGSLARAGKVKGQTPKV 45 GKVHGSLARAGKV+GQTPKV Sbjct: 2 GKVHGSLARAGKVRGQTPKV 21 >10_06_0161 + 11344712-11344877,11345870-11346084 Length = 126 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -2 Query: 293 AIDTRPGRQWPGVIGQIKERIRTLAAVGDEDLTLSLCG 180 A+DT GR+W G+ G E + +GD L L L G Sbjct: 38 AVDTGGGRKWRGLGGGGAELVLRTLGIGDMVLFLVLVG 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,490,293 Number of Sequences: 37544 Number of extensions: 230827 Number of successful extensions: 647 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1768474200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -