BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30509 (533 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6115| Best HMM Match : efhand (HMM E-Value=0.22) 29 1.8 SB_51871| Best HMM Match : Gag_p12 (HMM E-Value=5.8) 27 9.6 >SB_6115| Best HMM Match : efhand (HMM E-Value=0.22) Length = 822 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +1 Query: 94 HVPTRARRQAGSFTVNS---DGTSGAALKVPLTGNDKNVLSAIGSADFNDRHK 243 HVP + G + NS T G+ + +PL ++K V+ +G ND HK Sbjct: 526 HVP-KVGSHGGVYFWNSFRNKDTDGSLIVLPLKDHEKRVIGLLGVDTLNDSHK 577 >SB_51871| Best HMM Match : Gag_p12 (HMM E-Value=5.8) Length = 458 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/58 (24%), Positives = 25/58 (43%) Frame = -1 Query: 293 PCPXTLSRASPCGAALSLWRSLKSADPMALSTFLSLPVRGTFRAAPEVPSEFTVKLPA 120 PC L PC + ++ + S+ ++ T R AP +PS + ++PA Sbjct: 251 PCTSRLRSGRPCSSRAVTFKDPRGVGVAKASSTVTNGAEKTPRDAPSIPSTPSKEIPA 308 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.312 0.128 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,200,281 Number of Sequences: 59808 Number of extensions: 224108 Number of successful extensions: 487 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 487 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1203486867 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -