BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30509 (533 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive ... 25 1.6 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 24 2.8 AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcript... 23 6.4 DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 8.5 AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 23 8.5 >AF203337-1|AAF19832.1| 184|Anopheles gambiae immune-responsive serine protease-relatedprotein ISPR9 protein. Length = 184 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +1 Query: 211 IGSADFNDRHKLSAAPQGLALDNVXGHGLSLTG 309 +G+ N K + PQ L NV G G +TG Sbjct: 33 VGTGTQNPLDKTVSVPQKCGLRNVDGVGFRITG 65 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.2 bits (50), Expect = 2.8 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +2 Query: 443 TSTRWAXEWTTCSNRRWAHR 502 T RW EW + RW +R Sbjct: 850 TMERWQREWDESVHGRWTYR 869 >AB090814-2|BAC57904.1| 1049|Anopheles gambiae reverse transcriptase protein. Length = 1049 Score = 23.0 bits (47), Expect = 6.4 Identities = 9/23 (39%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 434 TRPTSTR-WAXEWTTCSNRRWAH 499 +R S R W EW+ N RW + Sbjct: 903 SRQASMRQWQNEWSNSLNGRWTY 925 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 22.6 bits (46), Expect = 8.5 Identities = 9/20 (45%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -3 Query: 204 EHVL-VVAGERDLQGGPGGS 148 +HV+ ++ +R +GGPGGS Sbjct: 90 KHVVDMIQAQRSPRGGPGGS 109 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 22.6 bits (46), Expect = 8.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 452 RWAXEWTTCSNRRWAHR 502 +W E T + RWAHR Sbjct: 880 QWDAEADTSRHTRWAHR 896 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.312 0.128 0.355 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 432,021 Number of Sequences: 2352 Number of extensions: 7281 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49474503 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.9 bits)
- SilkBase 1999-2023 -