BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30508 (680 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g13230.1 68414.m01535 leucine-rich repeat family protein cont... 29 3.8 At2g17110.1 68415.m01974 expressed protein 28 5.0 >At1g13230.1 68414.m01535 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to gb|U42445 Cf-2.2 from Lycopersicon pimpinellifolium Length = 424 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 112 QIKIEIFKLLYLHNCDFFNCRIILLITTSDD 204 QI+ E+F+L +L + FFNC I ++ ++ Sbjct: 105 QIRPELFELKHLRSLSFFNCFISPMVIAKEE 135 >At2g17110.1 68415.m01974 expressed protein Length = 733 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -3 Query: 660 FVEHFHRYRQMFKFFKCNPKLQQGSEH 580 F+ H HRY K PK+ GS H Sbjct: 55 FINHHHRYNDSDSPKKAKPKMDSGSGH 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,506,979 Number of Sequences: 28952 Number of extensions: 196876 Number of successful extensions: 325 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 319 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -