BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30475 (634 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||... 29 0.56 SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccha... 28 0.97 SPAC4G8.07c |||tRNA |Schizosaccharomyces pombe|chr 1|||Manual 27 2.3 SPAC27D7.06 |||electron transfer flavoprotein alpha subunit|Schi... 27 3.0 SPAC25H1.04 |mug105||DUF1671 family protein|Schizosaccharomyces ... 25 6.9 SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosacc... 25 6.9 SPBC725.16 |res1|sct1|MBF transcription factor complex subunit R... 25 9.1 >SPCP1E11.03 |mug170||arrestin|Schizosaccharomyces pombe|chr 3|||Manual Length = 426 Score = 29.1 bits (62), Expect = 0.56 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = -3 Query: 344 ENTVRAPVRLPAHRSGAPAGRLRSIRVRDRLKMEFTVAVSTSAFLDTSI 198 +NT+ A +++P RS+ ++D+LK+++T+ V SAF I Sbjct: 372 KNTIHAQIKIPEF--------CRSVNLKDQLKIDYTLEVCFSAFFKPRI 412 >SPAC23E2.03c |ste7||meiotic suppressor protein Ste7|Schizosaccharomyces pombe|chr 1|||Manual Length = 569 Score = 28.3 bits (60), Expect = 0.97 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +2 Query: 17 AIRAERDAPFSEDLPPAEDTVH 82 A+ R+ FSE LP AED VH Sbjct: 473 ALSCHRNLSFSESLPTAEDQVH 494 >SPAC4G8.07c |||tRNA |Schizosaccharomyces pombe|chr 1|||Manual Length = 527 Score = 27.1 bits (57), Expect = 2.3 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +3 Query: 45 SARTFLRQRTLYMPAGAEPAHQHALQVAPVSHTSQVHDLKIRK 173 SART R ++P + P H+ A + +S S+ + + RK Sbjct: 29 SARTLKICRFRFLPTPSHPTHKMAQETRAISSISEAANKRARK 71 >SPAC27D7.06 |||electron transfer flavoprotein alpha subunit|Schizosaccharomyces pombe|chr 1|||Manual Length = 341 Score = 26.6 bits (56), Expect = 3.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 55 PSSGRGHCTCLPGRSPRTSMLYKWL 129 PSSG G T + G P+ + L +W+ Sbjct: 186 PSSGEGAATVVEGIDPKPAALQEWV 210 >SPAC25H1.04 |mug105||DUF1671 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 244 Score = 25.4 bits (53), Expect = 6.9 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 597 KKPKNIFIFNHTSLRRKRSIR 535 KK NI FNH +R+KRS++ Sbjct: 192 KKFVNIADFNHCYMRKKRSLK 212 >SPAC29A4.16 |hal4|sat4, ppk10|halotolerence protein 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 636 Score = 25.4 bits (53), Expect = 6.9 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 367 PPGSPQPPKTRFGPRSGSP 311 PP S QPP T G + SP Sbjct: 36 PPSSQQPPSTPNGKEAASP 54 >SPBC725.16 |res1|sct1|MBF transcription factor complex subunit Res1|Schizosaccharomyces pombe|chr 2|||Manual Length = 637 Score = 25.0 bits (52), Expect = 9.1 Identities = 9/30 (30%), Positives = 18/30 (60%) Frame = -2 Query: 156 HEPEMYEIPEPLVEHAGARAPPRQACTVSS 67 HE ++++ +PL+E++G+ P T S Sbjct: 89 HEYNVFDLIQPLIEYSGSAFMPMSTFTPQS 118 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,253,733 Number of Sequences: 5004 Number of extensions: 40474 Number of successful extensions: 130 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 130 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 281707720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -