BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30475 (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27954| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_24681| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.34 SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) 28 5.5 SB_43658| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42) 28 7.2 SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_27954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 567 Score = 37.1 bits (82), Expect = 0.012 Identities = 15/30 (50%), Positives = 22/30 (73%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAG 92 K+FV +Y++S MPP +TFLRQ+T + G Sbjct: 479 KVFVAVYDVSDMPPLTQTFLRQKTFSVRKG 508 >SB_24681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 32.3 bits (70), Expect = 0.34 Identities = 11/18 (61%), Positives = 17/18 (94%) Frame = +1 Query: 151 FMTSKSGKLYLHTDIRIL 204 F +S+SG++YLHTDIR++ Sbjct: 2 FASSRSGRIYLHTDIRVI 19 >SB_7305| Best HMM Match : Extensin_2 (HMM E-Value=0.043) Length = 908 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +1 Query: 52 GPSSGRGHCTCLPGRSPRTSMLYKWLRYLIHLRFMTSKSGKLY 180 GPS+ H R PR + L++ L +L LR+ T + LY Sbjct: 767 GPSNTPLHFPIPDPRKPRYTSLFRTLEHLTTLRYSTPSNTLLY 809 >SB_43658| Best HMM Match : Pkinase (HMM E-Value=1.49939e-42) Length = 457 Score = 27.9 bits (59), Expect = 7.2 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 140 MRYRSHL*SMLVRGLRPGRHVQCPLPEEGP 51 M++ +H S+ L P HVQCP EE P Sbjct: 138 MKHHAHHQSVPRHDLGPVSHVQCPCNEERP 167 >SB_40630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2174 Score = 27.9 bits (59), Expect = 7.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -1 Query: 373 RAPPGSPQPPKTRFGPRSGS 314 RAPP P PP +R RSGS Sbjct: 1762 RAPPPRPPPPSSRGHSRSGS 1781 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,251,098 Number of Sequences: 59808 Number of extensions: 355278 Number of successful extensions: 1119 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1119 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -