BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30475 (634 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC109128-1|AAI09129.1| 1076|Homo sapiens KIAA1370 protein. 56 1e-07 BC109127-1|AAI09128.1| 1076|Homo sapiens KIAA1370 protein. 56 1e-07 BC073908-1|AAH73908.1| 105|Homo sapiens KIAA1370 protein protein. 56 1e-07 BC058839-1|AAH58839.1| 396|Homo sapiens KIAA1370 protein protein. 56 1e-07 AK001842-1|BAA91936.1| 385|Homo sapiens protein ( Homo sapiens ... 56 1e-07 AB037791-1|BAA92608.1| 1107|Homo sapiens KIAA1370 protein protein. 56 1e-07 BC083498-1|AAH83498.1| 241|Homo sapiens KIAA1370 protein protein. 56 1e-07 BC004406-1|AAH04406.1| 538|Homo sapiens KIAA1539 protein. 47 6e-05 AL353795-9|CAH71001.1| 538|Homo sapiens KIAA1539 protein. 47 6e-05 AL353795-7|CAH70999.1| 233|Homo sapiens KIAA1539 protein. 47 6e-05 AC004472-5|AAC07982.1| 188|Homo sapiens P1.11659_5 protein. 47 6e-05 AB040972-1|BAA96063.1| 543|Homo sapiens KIAA1539 protein protein. 47 6e-05 AJ415110-1|CAC94244.1| 91|Homo sapiens immunoglobulin lambda c... 33 0.84 BC067736-1|AAH67736.1| 478|Homo sapiens RGM domain family, memb... 31 2.6 X98750-1|CAA67301.1| 111|Homo sapiens variable immunoglobulin a... 31 3.4 K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary ... 31 3.4 AF103642-1|AAD16702.1| 110|Homo sapiens immunoglobulin lambda l... 31 4.5 L08237-1|AAA74509.1| 166|Homo sapiens MG21 protein. 30 5.9 DQ172541-1|ABA70856.1| 129|Homo sapiens immunoglobulin lambda l... 30 5.9 AY942030-1|AAY33378.1| 110|Homo sapiens anti-rabies virus immun... 30 7.8 AJ426382-1|CAD20004.1| 96|Homo sapiens immunoglobulin lambda l... 30 7.8 AF103653-1|AAD16713.1| 109|Homo sapiens immunoglobulin lambda l... 30 7.8 AB038782-1|BAB12116.1| 878|Homo sapiens intestinal mucin protein. 30 7.8 >BC109128-1|AAI09129.1| 1076|Homo sapiens KIAA1370 protein. Length = 1076 Score = 56.0 bits (129), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 1019 LRYLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 1062 Score = 40.7 bits (91), Expect = 0.004 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMFVV+Y+L MP + +TFLRQRT +P E Sbjct: 970 KMFVVIYDLRDMPANHQTFLRQRTFSVPVKQE 1001 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 1051 EVDSGAAYELKSYTESPTNPQFSPR 1075 >BC109127-1|AAI09128.1| 1076|Homo sapiens KIAA1370 protein. Length = 1076 Score = 56.0 bits (129), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 1019 LRYLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 1062 Score = 40.7 bits (91), Expect = 0.004 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMFVV+Y+L MP + +TFLRQRT +P E Sbjct: 970 KMFVVIYDLRDMPANHQTFLRQRTFSVPVKQE 1001 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 1051 EVDSGAAYELKSYTESPTNPQFSPR 1075 >BC073908-1|AAH73908.1| 105|Homo sapiens KIAA1370 protein protein. Length = 105 Score = 56.0 bits (129), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 48 LRYLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 91 Score = 36.7 bits (81), Expect = 0.068 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +3 Query: 9 FVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 FVV+Y+L MP + +TFLRQRT +P E Sbjct: 1 FVVIYDLRDMPANHQTFLRQRTFSVPVKQE 30 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 80 EVDSGAAYELKSYTESPTNPQFSPR 104 >BC058839-1|AAH58839.1| 396|Homo sapiens KIAA1370 protein protein. Length = 396 Score = 56.0 bits (129), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 339 LRYLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 382 Score = 40.7 bits (91), Expect = 0.004 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMFVV+Y+L MP + +TFLRQRT +P E Sbjct: 290 KMFVVIYDLRDMPANHQTFLRQRTFSVPVKQE 321 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 371 EVDSGAAYELKSYTESPTNPQFSPR 395 >AK001842-1|BAA91936.1| 385|Homo sapiens protein ( Homo sapiens cDNA FLJ10980 fis, clone PLACE1001570. ). Length = 385 Score = 56.0 bits (129), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 328 LRYLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 371 Score = 40.7 bits (91), Expect = 0.004 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMFVV+Y+L MP + +TFLRQRT +P E Sbjct: 279 KMFVVIYDLRDMPANHQTFLRQRTFSVPVKQE 310 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 360 EVDSGAAYELKSYTESPTNPQFSPR 384 >AB037791-1|BAA92608.1| 1107|Homo sapiens KIAA1370 protein protein. Length = 1107 Score = 56.0 bits (129), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 1050 LRYLIHLRFQSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 1093 Score = 40.7 bits (91), Expect = 0.004 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMFVV+Y+L MP + +TFLRQRT +P E Sbjct: 1001 KMFVVIYDLRDMPANHQTFLRQRTFSVPVKQE 1032 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 1082 EVDSGAAYELKSYTESPTNPQFSPR 1106 >BC083498-1|AAH83498.1| 241|Homo sapiens KIAA1370 protein protein. Length = 241 Score = 55.6 bits (128), Expect = 1e-07 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 127 LRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDTATVNSIFS 255 LRYLIHLRF +SKSGK+YLH D+R+L SRK+ +VD+ + S Sbjct: 184 LRYLIHLRFRSSKSGKIYLHRDVRLLFSRKSMEVDSGAAYELKS 227 Score = 40.7 bits (91), Expect = 0.004 Identities = 18/32 (56%), Positives = 23/32 (71%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMFVV+Y+L MP + +TFLRQRT +P E Sbjct: 135 KMFVVIYDLRDMPANHQTFLRQRTFSVPVKQE 166 Score = 34.7 bits (76), Expect = 0.28 Identities = 13/25 (52%), Positives = 20/25 (80%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSPR 500 E +G A+EL+S+T +P NP++SPR Sbjct: 216 EVDSGAAYELKSYTESPTNPQFSPR 240 >BC004406-1|AAH04406.1| 538|Homo sapiens KIAA1539 protein. Length = 538 Score = 46.8 bits (106), Expect = 6e-05 Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 91 GRSPRTSMLYKWLRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDT 231 G + ++ L YL+HLRF +S+SG+L LH DIR+L SR++ ++DT Sbjct: 469 GEEGNANPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDT 516 Score = 35.5 bits (78), Expect = 0.16 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMF+V ++ S MP + TFLR R +P G E Sbjct: 440 KMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEE 471 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSP 497 E G+ +EL++ T AP NPRYSP Sbjct: 513 ELDTGLPYELQAVTEAPHNPRYSP 536 >AL353795-9|CAH71001.1| 538|Homo sapiens KIAA1539 protein. Length = 538 Score = 46.8 bits (106), Expect = 6e-05 Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 91 GRSPRTSMLYKWLRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDT 231 G + ++ L YL+HLRF +S+SG+L LH DIR+L SR++ ++DT Sbjct: 469 GEEGNANPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDT 516 Score = 35.5 bits (78), Expect = 0.16 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMF+V ++ S MP + TFLR R +P G E Sbjct: 440 KMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEE 471 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSP 497 E G+ +EL++ T AP NPRYSP Sbjct: 513 ELDTGLPYELQAVTEAPHNPRYSP 536 >AL353795-7|CAH70999.1| 233|Homo sapiens KIAA1539 protein. Length = 233 Score = 46.8 bits (106), Expect = 6e-05 Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 91 GRSPRTSMLYKWLRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDT 231 G + ++ L YL+HLRF +S+SG+L LH DIR+L SR++ ++DT Sbjct: 164 GEEGNANPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDT 211 Score = 35.5 bits (78), Expect = 0.16 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMF+V ++ S MP + TFLR R +P G E Sbjct: 135 KMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEE 166 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSP 497 E G+ +EL++ T AP NPRYSP Sbjct: 208 ELDTGLPYELQAVTEAPHNPRYSP 231 >AC004472-5|AAC07982.1| 188|Homo sapiens P1.11659_5 protein. Length = 188 Score = 46.8 bits (106), Expect = 6e-05 Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 91 GRSPRTSMLYKWLRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDT 231 G + ++ L YL+HLRF +S+SG+L LH DIR+L SR++ ++DT Sbjct: 119 GEEGNANPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDT 166 Score = 35.5 bits (78), Expect = 0.16 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMF+V ++ S MP + TFLR R +P G E Sbjct: 90 KMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEE 121 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSP 497 E G+ +EL++ T AP NPRYSP Sbjct: 163 ELDTGLPYELQAVTEAPHNPRYSP 186 >AB040972-1|BAA96063.1| 543|Homo sapiens KIAA1539 protein protein. Length = 543 Score = 46.8 bits (106), Expect = 6e-05 Identities = 22/48 (45%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +1 Query: 91 GRSPRTSMLYKWLRYLIHLRFMTSKSGKLYLHTDIRILVSRKA-DVDT 231 G + ++ L YL+HLRF +S+SG+L LH DIR+L SR++ ++DT Sbjct: 474 GEEGNANPTHRLLCYLLHLRFRSSRSGRLSLHGDIRLLFSRRSLELDT 521 Score = 35.5 bits (78), Expect = 0.16 Identities = 15/32 (46%), Positives = 20/32 (62%) Frame = +3 Query: 3 KMFVVLYELSGMPPSARTFLRQRTLYMPAGAE 98 KMF+V ++ S MP + TFLR R +P G E Sbjct: 445 KMFLVTFDFSDMPAAHMTFLRHRLFLVPVGEE 476 Score = 31.9 bits (69), Expect = 1.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 426 ENHNGVAFELRSFTYAPDNPRYSP 497 E G+ +EL++ T AP NPRYSP Sbjct: 518 ELDTGLPYELQAVTEAPHNPRYSP 541 >AJ415110-1|CAC94244.1| 91|Homo sapiens immunoglobulin lambda chain variable region protein. Length = 91 Score = 33.1 bits (72), Expect = 0.84 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = +1 Query: 274 DLRRPAGAPDRCAGSRTGA 330 D RRP+G PDR +GSR+GA Sbjct: 41 DTRRPSGVPDRFSGSRSGA 59 >BC067736-1|AAH67736.1| 478|Homo sapiens RGM domain family, member B protein. Length = 478 Score = 31.5 bits (68), Expect = 2.6 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = +1 Query: 34 GCPLQRGPSSGRGHCTCLPGRS-PRTSMLYKWLRYLI 141 GCPL G+G + + G S PRTS++ W Y + Sbjct: 356 GCPLSERIDDGQGQVSAILGHSLPRTSLVQAWPGYTL 392 >X98750-1|CAA67301.1| 111|Homo sapiens variable immunoglobulin anti-Digoxigenin light chain protein. Length = 111 Score = 31.1 bits (67), Expect = 3.4 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = +1 Query: 274 DLRRPAGAPDRCAGSRTG 327 D RRP+GAPDR +GS++G Sbjct: 52 DNRRPSGAPDRFSGSKSG 69 >K02575-1|AAA36502.1| 173|Homo sapiens protein ( Human salivary proline-rich protein 1 gene, segment 1. ). Length = 173 Score = 31.1 bits (67), Expect = 3.4 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 367 PPGSPQPPKTRFGPRSGSPRTGP 299 PPG PQ P + G RS SPR+ P Sbjct: 56 PPGKPQGPPPQGGKRSRSPRSPP 78 >AF103642-1|AAD16702.1| 110|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 110 Score = 30.7 bits (66), Expect = 4.5 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +1 Query: 271 IDLRRPAGAPDRCAGSRTG 327 ID +RP+G PDR +GSR+G Sbjct: 44 IDDQRPSGVPDRISGSRSG 62 >L08237-1|AAA74509.1| 166|Homo sapiens MG21 protein. Length = 166 Score = 30.3 bits (65), Expect = 5.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 516 RXAHVSEESIWGCRGRT*NCVVRTRPRCGSRS 421 R AH+ GCRGRT PRCGS+S Sbjct: 135 RDAHIPGPCPAGCRGRTPEEEAGEWPRCGSKS 166 >DQ172541-1|ABA70856.1| 129|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 129 Score = 30.3 bits (65), Expect = 5.9 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +1 Query: 274 DLRRPAGAPDRCAGSRTG 327 D+ RP+G PDR +GSR+G Sbjct: 55 DMSRPSGVPDRFSGSRSG 72 >AY942030-1|AAY33378.1| 110|Homo sapiens anti-rabies virus immunoglobulin light chain variable region protein. Length = 110 Score = 29.9 bits (64), Expect = 7.8 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +1 Query: 274 DLRRPAGAPDRCAGSRTG 327 D++RP+G PDR +GS++G Sbjct: 52 DIQRPSGVPDRFSGSKSG 69 >AJ426382-1|CAD20004.1| 96|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 96 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +1 Query: 274 DLRRPAGAPDRCAGSRTGA 330 D +RP+G PDR +GS++GA Sbjct: 40 DNQRPSGVPDRLSGSKSGA 58 >AF103653-1|AAD16713.1| 109|Homo sapiens immunoglobulin lambda light chain variable region protein. Length = 109 Score = 29.9 bits (64), Expect = 7.8 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 274 DLRRPAGAPDRCAGSRTGA 330 D RP+G PDR +GS++GA Sbjct: 43 DTNRPSGVPDRFSGSKSGA 61 >AB038782-1|BAB12116.1| 878|Homo sapiens intestinal mucin protein. Length = 878 Score = 29.9 bits (64), Expect = 7.8 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 13 SCYTS*AGCPLQRGPSSGRGHCTCLPGRS 99 S T+ AGC G + +G C CLPG S Sbjct: 503 STLTTTAGCTCDNGGTWEQGQCACLPGFS 531 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,399,361 Number of Sequences: 237096 Number of extensions: 1851760 Number of successful extensions: 11848 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 10770 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11827 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 6916500330 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -