BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30474 (713 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0480 + 3616123-3617506,3618033-3618166,3618578-3618818,361... 33 0.17 04_01_0112 + 1151242-1151272,1151722-1151928,1151996-1152318,115... 29 2.8 08_02_1344 - 26280554-26280785,26281558-26282182,26282718-26284224 28 6.4 01_01_1152 + 9170628-9171899 28 6.4 >07_01_0480 + 3616123-3617506,3618033-3618166,3618578-3618818, 3618912-3619120,3619234-3619265,3619363-3619474, 3619609-3619890 Length = 797 Score = 33.5 bits (73), Expect = 0.17 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +3 Query: 285 LKFLVLAIVPLSFAQNIPKATN--LHNGLTEKIGNFSIELLYHTSNLEQSKGN 437 ++FL I+P FA N+ K TN L L KIG+++I +L T E GN Sbjct: 610 IQFLHGGIIPGLFANNL-KITNILLDQNLVAKIGSYNIPILSETMKSEGGSGN 661 >04_01_0112 + 1151242-1151272,1151722-1151928,1151996-1152318, 1152552-1153793 Length = 600 Score = 29.5 bits (63), Expect = 2.8 Identities = 17/64 (26%), Positives = 30/64 (46%) Frame = +3 Query: 228 GIYETCFKRVE*TKLIMCLLKFLVLAIVPLSFAQNIPKATNLHNGLTEKIGNFSIELLYH 407 G +C +++ K + FL+ I P + N+ K +H G+ G F + L + Sbjct: 99 GTINSCLGKLQQLKYLNMERNFLMGEIAP-NLLINLTKLETIHLGVNNLTGTFMLSWLAN 157 Query: 408 TSNL 419 +SNL Sbjct: 158 SSNL 161 >08_02_1344 - 26280554-26280785,26281558-26282182,26282718-26284224 Length = 787 Score = 28.3 bits (60), Expect = 6.4 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = -3 Query: 582 EIFWNSLRVTFVCFACSRNA*LICRSYFQTRLQLSPP 472 E+ + + V C CS+ A + +S QTRL L PP Sbjct: 640 ELHFEAETVELTCENCSKFAQKLNKSVIQTRLSLLPP 676 >01_01_1152 + 9170628-9171899 Length = 423 Score = 28.3 bits (60), Expect = 6.4 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 435 NLIMSPITVWTVLAVIAEGASGNT 506 N I+SP++ LA++A+GA G T Sbjct: 60 NFIVSPLSFHAALALVADGARGET 83 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,911,433 Number of Sequences: 37544 Number of extensions: 348706 Number of successful extensions: 778 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 777 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -