BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30473 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 25 0.73 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 2.2 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 2.2 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.2 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 2.2 X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor pro... 23 3.9 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 22 5.2 AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 ... 22 5.2 AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor p... 21 9.0 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 25.0 bits (52), Expect = 0.73 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +3 Query: 576 SNVTAGPYVRGVAMNPVEHPHGGGNHQHIGKASTVKRGTSA 698 S+ A Y+ + VEHPH + QH G A V + T + Sbjct: 2 SSYFANSYIPDLRNGGVEHPH--QHQQHYGAAVQVPQQTQS 40 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 364 HFLFKIAHNGTLRHSSNRHHI 302 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 364 HFLFKIAHNGTLRHSSNRHHI 302 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 364 HFLFKIAHNGTLRHSSNRHHI 302 HF +I NGT+ + RH I Sbjct: 214 HFALRIYRNGTVNYLMRRHLI 234 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -1 Query: 364 HFLFKIAHNGTLRHSSNRHHI 302 HF +I NGT+ + RH I Sbjct: 163 HFALRIYRNGTVNYLMRRHLI 183 >X72577-1|CAA51169.1| 283|Apis mellifera Apidaecin precursor protein. Length = 283 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 157 DPGRGAPLAVVHFRDPYKFKTRKELFIAPEGSTRPI 264 +PG P+ + R P+ R+ A G+ RP+ Sbjct: 68 EPGNNRPVYIPQPRPPHPRLRREAELEAEPGNNRPV 103 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 157 DPGRGAPLAVVHFRDPYKFKTRKELFIAPEGSTRPI 264 +PG P+ + R P+ R+ A G+ RP+ Sbjct: 124 EPGNNRPVYIPQPRPPHPRLRREAELEAEPGNNRPV 159 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 157 DPGRGAPLAVVHFRDPYKFKTRKELFIAPEGSTRPI 264 +PG P+ + R P+ R+ A G+ RP+ Sbjct: 236 EPGNNRPVYIPQPRPPHPRLRREAKPEAKPGNNRPV 271 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 22.2 bits (45), Expect = 5.2 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 157 DPGRGAPLAVVHFRDPYKFKTRKELFIAPEGSTRPI 264 +PG P+ + R P+ R+ A G+ RP+ Sbjct: 69 EPGNNRPIYIPQPRPPHPRLRREAESEAEPGNNRPV 104 Score = 21.8 bits (44), Expect = 6.8 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 157 DPGRGAPLAVVHFRDPYKFKTRKELFIAPEGSTRPI 264 +PG P+ + R P+ R+ A G+ RPI Sbjct: 41 EPGNNRPIYIPQPRPPHPRLRREAEPKAEPGNNRPI 76 >AF441189-1|AAL73401.1| 134|Apis mellifera ribosomal protein 49 protein. Length = 134 Score = 22.2 bits (45), Expect = 5.2 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 413 IGHNPDAKRTRVKLPSGAKKVL 478 IG+ + K+TR LP+G +KVL Sbjct: 57 IGYGSN-KKTRHMLPTGFRKVL 77 >AF442148-1|AAL35349.1| 199|Apis mellifera apidaecin precursor protein. Length = 199 Score = 21.4 bits (43), Expect = 9.0 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = +1 Query: 157 DPGRGAPLAVVHFRDPYKFKTRKELFIAPEGSTRPI 264 +PG P+ + R P+ R+ A G+ RP+ Sbjct: 124 EPGNNRPVYIPQPRPPHPRLRREAKPEAEPGNNRPV 159 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 225,785 Number of Sequences: 438 Number of extensions: 5445 Number of successful extensions: 28 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -