BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30472 (697 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical p... 84 8e-17 AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical ... 29 2.4 Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical p... 29 4.2 Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical pr... 29 4.2 AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 prote... 29 4.2 AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 prote... 29 4.2 AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. 29 4.2 Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical pr... 28 5.5 U40958-3|ABQ13075.1| 219|Caenorhabditis elegans Hypothetical pr... 28 5.5 Z68010-3|CAA92011.1| 558|Caenorhabditis elegans Hypothetical pr... 28 7.3 Z67756-4|CAA91765.1| 558|Caenorhabditis elegans Hypothetical pr... 28 7.3 U23176-4|AAC46716.1| 632|Caenorhabditis elegans Fem-3 mrna bind... 28 7.3 L11247-1|AAA28010.2| 484|Caenorhabditis elegans Hypothetical pr... 28 7.3 AF005246-1|AAB95119.1| 556|Caenorhabditis elegans voltage-depen... 28 7.3 AC006656-6|AAF39879.1| 614|Caenorhabditis elegans Fem-3 mrna bi... 28 7.3 >Z79754-10|CAB02099.1| 181|Caenorhabditis elegans Hypothetical protein F25H2.11 protein. Length = 181 Score = 84.2 bits (199), Expect = 8e-17 Identities = 40/72 (55%), Positives = 53/72 (73%), Gaps = 2/72 (2%) Frame = +1 Query: 46 MKIYKDIITGDEMFSDTYKMKLVDEVIYEVTGRLVTRAQGDIQIEGFNPSAEEA--DEGT 219 M IYKDI T DE+ SD++ MKLVD+++YE G+ V R +G+I + G NPSAEE D+G+ Sbjct: 1 MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGS 60 Query: 220 DSAVESGVDIVL 255 D VE G+DIVL Sbjct: 61 DEHVERGIDIVL 72 Score = 58.8 bits (136), Expect = 3e-09 Identities = 34/93 (36%), Positives = 52/93 (55%), Gaps = 7/93 (7%) Frame = +3 Query: 255 NHRLVETYAFGDKKSYTLYLKDYMKKLVAKLEEKAPDQ--VEVFKTNMNKVMKDILG--R 422 NH+LVE + D + Y+K +MK ++ +E+ D+ V+ FK + + +L R Sbjct: 73 NHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDR 132 Query: 423 FKELQFFTGESM---DCDGMVAMMEYRDFDGTK 512 FK L FF GE +G VA++EYRD DGT+ Sbjct: 133 FKNLAFFIGERAAEGAENGQVAIIEYRDVDGTE 165 >AF101316-3|AAC69232.2| 508|Caenorhabditis elegans Hypothetical protein F52F10.2 protein. Length = 508 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 398 FVHVCFKYFNLVRRLLFQFCY*FFHI 321 F+++C +Y RR L FCY F I Sbjct: 137 FIYLCIEYLPTGRRYLMMFCYILFDI 162 >Z81054-12|CAB61006.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 291 KKSYTLYLKDYMKKLVAKLEEK 356 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >Z81032-6|CAB60991.1| 1781|Caenorhabditis elegans Hypothetical protein C02F4.1 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 291 KKSYTLYLKDYMKKLVAKLEEK 356 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >AY130758-2|AAN61518.1| 18519|Caenorhabditis elegans 2MDa_2 protein protein. Length = 18519 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 273 TYAFG--DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 437 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AY130758-1|AAN61517.1| 18534|Caenorhabditis elegans 2MDa_1 protein protein. Length = 18534 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 2/57 (3%) Frame = +3 Query: 273 TYAFG--DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKELQ 437 T+ FG D++ Y++ +KD KKL + E+ + TN K + G+ K L+ Sbjct: 11103 TFNFGQKDQEQYSMVMKDVSKKLARQNAEEIQSGKLIPTTNEEKTGLALTGKNKNLK 11159 >AF038576-1|AAC38973.1| 1781|Caenorhabditis elegans CED-5 protein. Length = 1781 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +3 Query: 291 KKSYTLYLKDYMKKLVAKLEEK 356 +K+Y YL+++MK LVA + EK Sbjct: 754 EKTYKQYLREFMKSLVALMSEK 775 >Z48544-2|CAA88437.1| 766|Caenorhabditis elegans Hypothetical protein ZK945.3 protein. Length = 766 Score = 28.3 bits (60), Expect = 5.5 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +3 Query: 288 DKKSYTLYLKDYMKKLVAKLEEKAPDQVEVFKTNMNKVMKDILGRFKE 431 +KK+ L L +K + K+EEKA K+ ++K +KD L R K+ Sbjct: 22 EKKAKGLKLNKVDRKRIVKIEEKA-----ALKSKVDKAVKDELERLKK 64 >U40958-3|ABQ13075.1| 219|Caenorhabditis elegans Hypothetical protein F09F9.5 protein. Length = 219 Score = 28.3 bits (60), Expect = 5.5 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -3 Query: 350 FQFCY*FFHIVFEVQCVGFLVTEGVCF 270 +Q C+ F H+ +GF GVCF Sbjct: 53 YQTCFGFMHVKIATCSIGFFALLGVCF 79 >Z68010-3|CAA92011.1| 558|Caenorhabditis elegans Hypothetical protein R07A4.1 protein. Length = 558 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 196 AEEADEGTDSAVESGVDIVLTTG*SKHTPSVT 291 +E +DEGT+S+ +GVD V+ G S+ + T Sbjct: 524 SENSDEGTNSSSTTGVDTVVKLGPSETAITTT 555 >Z67756-4|CAA91765.1| 558|Caenorhabditis elegans Hypothetical protein R07A4.1 protein. Length = 558 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 196 AEEADEGTDSAVESGVDIVLTTG*SKHTPSVT 291 +E +DEGT+S+ +GVD V+ G S+ + T Sbjct: 524 SENSDEGTNSSSTTGVDTVVKLGPSETAITTT 555 >U23176-4|AAC46716.1| 632|Caenorhabditis elegans Fem-3 mrna binding factor protein 2 protein. Length = 632 Score = 27.9 bits (59), Expect = 7.3 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +3 Query: 552 RNSKC*IRNNSIIPNWALDT 611 RNS+ R+N+++P W+LD+ Sbjct: 156 RNSRSFTRSNNVLPTWSLDS 175 >L11247-1|AAA28010.2| 484|Caenorhabditis elegans Hypothetical protein F09G8.5 protein. Length = 484 Score = 27.9 bits (59), Expect = 7.3 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -1 Query: 529 KHHDWYLVPSKSLYSIMATMPSQSIDSPVKN 437 KHH +LVP + +SI + +P+ + SP N Sbjct: 53 KHHSLFLVPKRRSFSI-SVLPAAAPSSPSSN 82 >AF005246-1|AAB95119.1| 556|Caenorhabditis elegans voltage-dependent potassium channelalpha subunit protein. Length = 556 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +1 Query: 196 AEEADEGTDSAVESGVDIVLTTG*SKHTPSVT 291 +E +DEGT+S+ +GVD V+ G S+ + T Sbjct: 522 SENSDEGTNSSSTTGVDTVVKLGPSETAITTT 553 >AC006656-6|AAF39879.1| 614|Caenorhabditis elegans Fem-3 mrna binding factor protein 1 protein. Length = 614 Score = 27.9 bits (59), Expect = 7.3 Identities = 9/20 (45%), Positives = 16/20 (80%) Frame = +3 Query: 552 RNSKC*IRNNSIIPNWALDT 611 RNS+ R+N+++P W+LD+ Sbjct: 154 RNSRSFTRSNNVLPTWSLDS 173 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,623,828 Number of Sequences: 27780 Number of extensions: 313829 Number of successful extensions: 881 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1602927856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -