BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30472 (697 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 23 3.7 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 4.8 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 4.8 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 6.4 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.5 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.5 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.5 AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase pro... 21 8.5 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/24 (37%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -3 Query: 500 KVSIFH-HGNHAITIHRLPSKELK 432 K+ +F H N IT++R P + K Sbjct: 151 KIHVFSLHDNKLITMYRFPQNQFK 174 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 448 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 350 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 4.8 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -1 Query: 448 PVKN*SSLNLPRMSFITLFMFVLNTSTWSGAFS 350 PV+ +L+LPR + F N+ T +G +S Sbjct: 197 PVQVVKNLHLPRFTLEKFFTDYCNSKTNTGEYS 229 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 21.8 bits (44), Expect = 6.4 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = -3 Query: 110 NFIL*VSENISSPVIMSL*IFILMDWRRLKIIKTE 6 +F+L VS I++ V + IF+ + W + ++++ + Sbjct: 230 SFLLYVSGFITTEVAGTYAIFLYISWHQKELVRRD 264 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 303 CRISCHRRRMFRLACG*DYVNSALDGRVRALVSLFSRR 190 C C RM YVNSAL+ + + +L RR Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRR 390 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 303 CRISCHRRRMFRLACG*DYVNSALDGRVRALVSLFSRR 190 C C RM YVNSAL+ + + +L RR Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRR 390 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.5 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -2 Query: 303 CRISCHRRRMFRLACG*DYVNSALDGRVRALVSLFSRR 190 C C RM YVNSAL+ + + +L RR Sbjct: 353 CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRR 390 >AB253417-1|BAE86928.1| 567|Apis mellifera alpha-glucosidase protein. Length = 567 Score = 21.4 bits (43), Expect = 8.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -2 Query: 576 FLSNI*NFSSSRPCLKNIMIGIWYHQSLYIPSWQPCHHN 460 F+ N+ S+S K I + Y IP+W P +H+ Sbjct: 310 FIKNVSRDSNSSDFKKLIDNWMTYMPPSGIPNWVPGNHD 348 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,392 Number of Sequences: 438 Number of extensions: 3728 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21317625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -