BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30469 (673 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0211 - 23636377-23636532,23636624-23636805,23637853-236379... 73 2e-13 02_04_0433 - 22891261-22891509,22892181-22892301,22892405-228924... 72 5e-13 02_02_0470 - 10700092-10700505 30 1.9 10_08_0951 - 21769342-21769752 29 4.5 09_06_0097 + 20845417-20845518,20845728-20846581,20846666-208467... 28 7.8 >04_04_0211 - 23636377-23636532,23636624-23636805,23637853-23637959, 23637997-23638280 Length = 242 Score = 72.9 bits (171), Expect = 2e-13 Identities = 44/89 (49%), Positives = 55/89 (61%), Gaps = 2/89 (2%) Frame = +1 Query: 250 PQRRKSFYPTQEKICASSGGRPFS--KHVRRIRPNLKIGTVCILLAGRHAGKRVVLVGIL 423 P RK PT+ + +SS FS + + +R ++ GTV ILLAGR GKRVV + L Sbjct: 64 PSTRKP-NPTKLRSPSSSNLPEFSLFRFILLMRSSITPGTVLILLAGRFMGKRVVFLKQL 122 Query: 424 PSGLLLVTGPFAFNSCPLRRIPQRYVIGT 510 SGLLLVTGPF N P+RR+ Q YVI T Sbjct: 123 KSGLLLVTGPFKINGVPIRRVNQPYVIAT 151 >02_04_0433 - 22891261-22891509,22892181-22892301,22892405-22892496, 22892692-22892755,22892855-22892920,22893102-22893193, 22893991-22894050,22894181-22894270,22894484-22894613, 22895066-22895157,22895299-22895373,22895663-22895754, 22896496-22896586,22897541-22897574,22897745-22897791, 22899110-22899209,22899300-22899436,22900837-22901015, 22901146-22901188,22901264-22901297,22901839-22901948, 22902043-22902224,22903062-22903168,22903266-22903480 Length = 833 Score = 71.7 bits (168), Expect = 5e-13 Identities = 34/59 (57%), Positives = 42/59 (71%) Frame = +1 Query: 334 RIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIGT 510 ++R + GTV ILLAGR+ GKRVV + L SGLLL+TGPF N P+RR+ Q YVI T Sbjct: 70 KLRSTITPGTVLILLAGRYMGKRVVFLKQLKSGLLLITGPFKINGVPIRRVNQAYVIAT 128 >02_02_0470 - 10700092-10700505 Length = 137 Score = 29.9 bits (64), Expect = 1.9 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +1 Query: 349 LKIGTVCILLAGRHAGKRVVLVGILPSG 432 LK G ILL GR+AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRYAGRKAVIVRVFEEG 32 >10_08_0951 - 21769342-21769752 Length = 136 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = +1 Query: 349 LKIGTVCILLAGRHAGKRVVLVGILPSG 432 LK G ILL GR AG++ V+V + G Sbjct: 5 LKPGKAVILLQGRFAGRKAVIVRVFEEG 32 >09_06_0097 + 20845417-20845518,20845728-20846581,20846666-20846726, 20847320-20847358,20847602-20847682 Length = 378 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/47 (25%), Positives = 20/47 (42%) Frame = -1 Query: 382 QRGECKQFLSSGWVGSCVHAC*MDGHQMKHRFSPEWGRRTSYVEGYC 242 ++ CK+ +S W VH C + E G ++EG+C Sbjct: 179 EKNRCKRLISIFWALGIVHFCLFWVKFGLKKHEKELGSSVGWIEGFC 225 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,210,056 Number of Sequences: 37544 Number of extensions: 384967 Number of successful extensions: 950 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1703141568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -