BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30469 (673 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 24 3.8 AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. 24 5.0 AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. 24 5.0 AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. 23 8.8 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 24.2 bits (50), Expect = 3.8 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +3 Query: 264 VLLPHSGENLCFIWWPSIQQACTQDP 341 V P S EN+ W+P I+ C P Sbjct: 87 VASPSSFENVTSKWYPEIKHHCPDAP 112 >AY578805-1|AAT07310.1| 753|Anopheles gambiae medea protein. Length = 753 Score = 23.8 bits (49), Expect = 5.0 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +1 Query: 322 KHVR--RIRPNLKIGTVCILLAGRHAGKRVVLVGILPSGLLLVTGP 453 KHV+ + +LK +VC+ + +RVV GI SGL L +GP Sbjct: 109 KHVKFCQFAFDLKCDSVCV---NPYHYERVVSPGIDLSGLTLQSGP 151 >AY578795-1|AAT07300.1| 441|Anopheles gambiae Gbb-60A2 protein. Length = 441 Score = 23.8 bits (49), Expect = 5.0 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = -1 Query: 307 HQMKHRFSPEWGRRTSYVEGYCSGSPILLTSNLLYNNSQXLG 182 H++ S +GR ++ GYC G ++ + L S +G Sbjct: 259 HEVGLILSNRFGRYQPFLVGYCKGPELVKPTAALAGGSGTVG 300 >AF042732-2|AAC18057.1| 179|Anopheles gambiae TU37B2 protein. Length = 179 Score = 23.0 bits (47), Expect = 8.8 Identities = 9/27 (33%), Positives = 18/27 (66%) Frame = -1 Query: 208 LYNNSQXLGLLRLRVLFANXLVFSXLV 128 L NN++ L L++++ +FA F+ L+ Sbjct: 73 LKNNNRDLSLVKMKSMFAIGFAFTALL 99 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 686,574 Number of Sequences: 2352 Number of extensions: 14093 Number of successful extensions: 21 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67322955 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -