BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30468 (525 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|... 42 0.007 UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 35 1.3 UniRef50_Q08BD9 Cluster: Zgc:153909; n=4; Danio rerio|Rep: Zgc:1... 33 4.0 UniRef50_Q8SV02 Cluster: Putative uncharacterized protein ECU07_... 33 5.3 >UniRef50_A0MNZ0 Cluster: NADPH oxidoreductase; n=1; Bombyx mori|Rep: NADPH oxidoreductase - Bombyx mori (Silk moth) Length = 191 Score = 42.3 bits (95), Expect = 0.007 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 139 WVDELTAHLMLSGYWSP 189 WVDELTAHL+LSGYWSP Sbjct: 159 WVDELTAHLVLSGYWSP 175 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 34.7 bits (76), Expect = 1.3 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = +2 Query: 320 WYLPARTHNRSYHQ 361 WYLPARTH RSYH+ Sbjct: 572 WYLPARTHKRSYHR 585 >UniRef50_Q08BD9 Cluster: Zgc:153909; n=4; Danio rerio|Rep: Zgc:153909 - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 262 Score = 33.1 bits (72), Expect = 4.0 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 243 LSIVQRLPHPSNRNALL-LHGRNRQGGGTYPRGLTTGPTTSKNI 371 +++ RL HP R ++ LHG+ R GGG RG+ G T K++ Sbjct: 87 MNVKARLGHPVGRGGMMGLHGQMR-GGGRSRRGMVKGFCTKKSV 129 >UniRef50_Q8SV02 Cluster: Putative uncharacterized protein ECU07_0900; n=1; Encephalitozoon cuniculi|Rep: Putative uncharacterized protein ECU07_0900 - Encephalitozoon cuniculi Length = 372 Score = 32.7 bits (71), Expect = 5.3 Identities = 14/23 (60%), Positives = 16/23 (69%) Frame = +3 Query: 273 SNRNALLLHGRNRQGGGTYPRGL 341 + RNALL+HG N G TY RGL Sbjct: 112 TKRNALLVHGFNGSGNSTYMRGL 134 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 461,314,866 Number of Sequences: 1657284 Number of extensions: 8293824 Number of successful extensions: 14539 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 14277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14537 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 33037407449 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -