BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30468 (525 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1461 - 27299891-27301870 30 1.3 03_05_0629 + 26248960-26249236,26249766-26249894,26250291-262508... 29 3.0 11_01_0305 + 2299681-2299860,2299940-2300260,2300346-2300600 27 9.2 01_06_1749 - 39636951-39638102 27 9.2 >08_02_1461 - 27299891-27301870 Length = 659 Score = 29.9 bits (64), Expect = 1.3 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +3 Query: 267 HPSNRNALLLHGRNRQGGGTYPRGLTTGPTTSK 365 H ++ LL GR R GGG + RGL P S+ Sbjct: 282 HAADLRKKLLRGRRRGGGGGHRRGLFVFPLVSR 314 >03_05_0629 + 26248960-26249236,26249766-26249894,26250291-26250847, 26250933-26251250 Length = 426 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +2 Query: 47 HTRLLSSVYSIPFAVILHISHXXXXXXYCLDGWTSSQ 157 H R+ +Y+IPF ++L ++ L WTS Q Sbjct: 150 HFRIYPIIYAIPFVIVLGKNYAGPAGRPILTQWTSKQ 186 >11_01_0305 + 2299681-2299860,2299940-2300260,2300346-2300600 Length = 251 Score = 27.1 bits (57), Expect = 9.2 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = -1 Query: 240 LTTYISRWVAHLRCRC 193 LTT + W AH RCRC Sbjct: 121 LTTALPPWEAHPRCRC 136 >01_06_1749 - 39636951-39638102 Length = 383 Score = 27.1 bits (57), Expect = 9.2 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +2 Query: 242 SQYSSTAAPPFKPKRITA 295 S +S AAPPF P RIT+ Sbjct: 164 SSVASAAAPPFDPSRITS 181 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,532,330 Number of Sequences: 37544 Number of extensions: 237924 Number of successful extensions: 424 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 424 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1154538620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -