BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30468 (525 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) 28 5.4 SB_25073| Best HMM Match : Extensin_2 (HMM E-Value=0.27) 27 7.2 >SB_51372| Best HMM Match : Pyr_redox (HMM E-Value=3e-12) Length = 872 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 252 VQRLPHPSNRNALLLHGRNRQ 314 VQR P P+ RN++ LHG Q Sbjct: 30 VQRRPEPTPRNSIFLHGLRAQ 50 >SB_25073| Best HMM Match : Extensin_2 (HMM E-Value=0.27) Length = 744 Score = 27.5 bits (58), Expect = 7.2 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +2 Query: 182 GAHRHLQRKCATHLEI*VVRSQYSSTAAPPFKPKRITASRQK*AGRWY 325 G R +KC L R + S A P+ P + + +QK RW+ Sbjct: 101 GKRRTRDKKCIEALRAQSKRDKRRSFARDPWSPNKRSERKQKRVKRWF 148 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,235,500 Number of Sequences: 59808 Number of extensions: 262267 Number of successful extensions: 408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 358 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -