BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30468 (525 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00063-3|AAK18959.2| 446|Caenorhabditis elegans Hypothetical pr... 28 3.6 AC006632-10|AAK85471.1| 293|Caenorhabditis elegans Hypothetical... 28 3.6 >U00063-3|AAK18959.2| 446|Caenorhabditis elegans Hypothetical protein F56C9.3 protein. Length = 446 Score = 28.3 bits (60), Expect = 3.6 Identities = 13/52 (25%), Positives = 26/52 (50%) Frame = -2 Query: 242 TLQLISQGGWRIYVVDVYGLQ*PLNIKWAVSSSTHPSNXXXXXKSVICEELR 87 ++QLI RI+ VYG++ P+N+ W + + +IC++ + Sbjct: 218 SVQLIISSVRRIHDAAVYGIKDPINVSWPTIAIMGSTIAVKLTLFIICQKYK 269 >AC006632-10|AAK85471.1| 293|Caenorhabditis elegans Hypothetical protein F28A10.5 protein. Length = 293 Score = 28.3 bits (60), Expect = 3.6 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = -2 Query: 266 GQPLNYTETLQLISQGGWRIYVVD 195 G PLN+ E LQ +++ G+RI+ VD Sbjct: 234 GTPLNHFELLQTMAKYGFRIFNVD 257 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,583,452 Number of Sequences: 27780 Number of extensions: 197333 Number of successful extensions: 342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 339 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1028310386 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -