BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30463 (579 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosa... 28 1.1 SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyce... 26 3.5 SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|... 25 6.1 SPBC776.04 |sec2302|sec23-b|GTPase activating protein Sec23b |Sc... 25 6.1 SPAC1A6.04c |plb1||phospholipase B homolog Plb1|Schizosaccharomy... 25 8.0 SPAC6G9.03c |mug183||histone chaperone Rtt106-like|Schizosacchar... 25 8.0 >SPAC13G7.13c |msa1|SPAC6C3.01c|RNA-binding protein Msa1|Schizosaccharomyces pombe|chr 1|||Manual Length = 533 Score = 27.9 bits (59), Expect = 1.1 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = +2 Query: 194 SLPPGLQGSSLGKDFSPVYSRPGSVPRTTATFNYDSGSQQSGH 322 +LPPG +S+ + + P+YS ++P++ + Y G+ Sbjct: 491 TLPPGAVPTSIPQSYYPIYSPEMAMPQSYSPMYYTHNPPMDGN 533 >SPCC330.11 |btb1||BTB/POZ domain protein Btb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1347 Score = 26.2 bits (55), Expect = 3.5 Identities = 13/45 (28%), Positives = 23/45 (51%) Frame = -2 Query: 464 DIDSTRLSTRQPSRVIVSYIISATNWIVLSGYWAATNALLNCRRH 330 D S++ STR + +I +++ L W A N+L+ C R+ Sbjct: 442 DSTSSKNSTRTSFKFTPLWIFESSDLAALDIAWTADNSLILCTRN 486 >SPAC17G6.12 |cul1|pcu1|cullin 1|Schizosaccharomyces pombe|chr 1|||Manual Length = 767 Score = 25.4 bits (53), Expect = 6.1 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = -1 Query: 456 FHTPEH-TSTFQGYCKLYYQCH 394 FH PE ++G+ YY CH Sbjct: 548 FHLPEELVPLYEGFQNYYYSCH 569 >SPBC776.04 |sec2302|sec23-b|GTPase activating protein Sec23b |Schizosaccharomyces pombe|chr 2|||Manual Length = 765 Score = 25.4 bits (53), Expect = 6.1 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 354 CIVELQATLWWCPDCWE 304 C V+L+A W CP C++ Sbjct: 68 CHVDLRARFWICPFCFQ 84 >SPAC1A6.04c |plb1||phospholipase B homolog Plb1|Schizosaccharomyces pombe|chr 1|||Manual Length = 613 Score = 25.0 bits (52), Expect = 8.0 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 327 TMSPAIQQCIRSCPVTAEYNPVCGTDNITYNNPGRL 434 T SP QQC + + Y+ D+I YN RL Sbjct: 574 TASPECQQCYYNYCWSGLYDDSAANDDIVYNPTCRL 609 >SPAC6G9.03c |mug183||histone chaperone Rtt106-like|Schizosaccharomyces pombe|chr 1|||Manual Length = 352 Score = 25.0 bits (52), Expect = 8.0 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +3 Query: 315 LGTTTMSPAIQQCIRSCPVTAEYNPVCGTDNITY 416 +GT+T+SP++++ + CP NP G + TY Sbjct: 175 IGTSTLSPSVEEFV--CP-----NPQTGDNGTTY 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,034,391 Number of Sequences: 5004 Number of extensions: 37960 Number of successful extensions: 88 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 248115846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -