BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= heS30463 (579 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 1.6 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 6.7 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 6.7 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 6.7 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 6.7 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 6.7 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.4 bits (48), Expect = 1.6 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -2 Query: 419 IVSYIISATNWIVLSGYWAATNALLNC 339 + +Y+I NW + W + L+NC Sbjct: 258 VPTYLIKWKNWDLKYNTWEPISNLINC 284 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 417 CKLYYQCHKLDCTQRLL 367 CKL+ C L CT +L Sbjct: 109 CKLWLTCDVLCCTASIL 125 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 417 CKLYYQCHKLDCTQRLL 367 CKL+ C L CT +L Sbjct: 109 CKLWLTCDVLCCTASIL 125 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 6.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +2 Query: 317 GHHHNVACNSTMH 355 G+HHNV + T+H Sbjct: 1678 GYHHNVNKHCTIH 1690 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 6.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -1 Query: 417 CKLYYQCHKLDCTQRLL 367 CKL+ C L CT +L Sbjct: 109 CKLWLTCDVLCCTASIL 125 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 6.7 Identities = 13/46 (28%), Positives = 17/46 (36%) Frame = +2 Query: 194 SLPPGLQGSSLGKDFSPVYSRPGSVPRTTATFNYDSGSQQSGHHHN 331 S P L G D + G PR G + SG+H+N Sbjct: 156 SQPGSLNGYG-SSDGCDARKKKGPTPRQQEELCLVCGDRASGYHYN 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,226 Number of Sequences: 438 Number of extensions: 2915 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 16748661 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -